ELFH4 h4 (44 S S T Tj  ٌ ٌ/usr/lib/ld.so.1 r[; U|Te3G&eCFN]{0:zK.x?O$2^6&<G~>s*KEpv6exj=.G{%1=cwwd-{)qIG9R+H/d BsPlTiY8N#>&+LC |cnx>65y6Ht^=W0 /3M'1IB~?[iv<K\ou,f>]V \?b%Mq0c_=_QjW)~ED4!8:;`% 9W''uwv(7ti8F@-c y{")"KnYt2bfg'JVvmV 3D`-{(,jX.m2spSg&f.H02IXmRnbskwK8N*R34Qz7/4J@*R}{fIHQJxr7EePg#] }&k 1UnDkCa+a< Tf(QIM=%m[8;Fj/[3ME#aN a &QiTa_~iQf@^XyLXyxQH Ah,!ZOkynG|S"q5wlbG_E#s+BTolDWzwihU 2N<]U}@4[PtS@c$\9bYgF!}vuv~||VjU|3UT:b!E(p)_<"[RzC}*Ho R]5218y S->ZA6/%gPg\!g?Y4:^me{F5wfVF1N^'$v\p!C;c~/u-e)Hz9 BX"\D1)F<aAT)PM#@}AUZ 5D?iyZ5Boh  %I.dh0#A^DpE$h'aO0q*WXI+7"z OdpS4,O\t9+z*9`1l4 x 'GurR j|*;oq2SOJ67OJ`q-rLLhZsZ-M>Ck+m WVu,]`tA7 k$M(n:==`ll#_8!@cCP9$X$tlWN7[Ydd0o< (?Y `3n. }>&%Zh,m(uo:Pr65"x:;LK  rbrS V;?LAd^BJLk,j   JBp_ sKqY./e]~8(@dH ό Ϩ  T t ٌ H     ( *1< 7C CSP K \< Z-` ipT p  (  d d 4  ) ~   N"% ')  7 0L@T ] u4 /<l ,Dh   W $P - d( 4  4P   @ 4X .d  Ed \P  hD s `   l, x .x  Ws4  XR  .Th$ 5Upp DXt M@ _<  s|H t b  l  Ht H <  t,L h WP  | < 2  @e N% Y |q lP  < d lT p@ D @ -4   ,  &  D @K ]^D, g  {}D x  ` , d  Dh 4 ) Ll (  9X I  U4 cXt }x 8 )  d`    W,t@  #s\ 9| I W( eD q8  iL <0 J4   h    WCp 34 >4 [ ,` 4 jd q X\, ]4 D(   t X m P #  *5d@ ?,X IpX V$ b mX x   [\ v . X H l d <, L  P$ X L ; T J P W | `XtL qȰ $ X  [h, Ϩ ,  $ X   `$ P 4$H COT U10t kD w 4 \ \  s0 ,P\ o  T  $ '  0H GfL V mX tX }?` ( 0D ( Z`| $  9 RH@ m  4 .P4 M  a4, j% s <  8 || P \|  4@  X 8  %   # 9:  J V-  bUL l L ؤh *  h _0D d  nD $  h  ΄ { -  F0t  VKt8 l wW  ^ H ˠ| X  J@ 0<   " / 4U8 A4 K@!P  Vdp aL t   VD /\ ̘  ]pT `L X  4 * ` G @P` c($ y HD tX )` \h 4 ( ,   v d 0 +X 98 C T h^+, ld z T   @ _ ޼x l  D vh  -0 Q 'st ? L( ^$P oX$z ؘf(  X(4  $ td Hd   | )X,3 | Ha dh,< z( ,H _8 T  8 _0 X0   Р  L T@ 0 | CW P \ LgD rh Z<T ,   C wt  8 ,| DǤD T P_$| k8 ~   ׄ0L 0D 4t P $ d, L \  /h ,\ >G` PX Zhl gU"x qQ N T Z@HT # \  8 \T (  < + 1, P  ]w( m/XL w4 hH  K   ֠   *,  / EnQ դXX g 8xUD, TL D X  հL L $  ؼH < T  sD 1 @ P( \`, nc |X  n4  Xd  | D h  t n&lP <X JH(( cĨ o }n   t   t ҄ Vl ,   :, ) (7HD E@ _ iQ r` mh 2 D , P  DnH\ `\  d -t| 9 D Q# ^ڔT p VT ~D _  ָ 0p )T  BdT 0  .R, > EƬ Qy _(d< r,@ "L ~8P D n lT 0 V4  s nl   4\ G@ \nh X vt z T (< % 8d  K  L `DD $ &l 8Y8 BZp Q  cPT s tP !DX  M | xl 0  U !<|  _$ ! Rl !h !+0 4 !7Tp !F,x !V !_n!l( !~  ! !Y@t !h !D !( ! H  " l "| "* "6P  "K T"Z0| "k "q a0 "0` "T0 "4 "(L "(x "= #4 # <L # ό #! 0 #/c  #= #H| #b '\ #m@< #}  #@ #K` #$ #  #x #&d # #vP $ J4 $ D$' $5ed $AP $\ش $r ל$x $X< $ $ $8P $h $( $ ph $ % %'kT %;x\ %Js, %\h, %s %Tt % ֔%n%l %,d %@ %'  %0@T %h( & &lx &-`l &=< &E &[H, &o@ &h & t&0DX & &s< & N & 'g ''n'2x '< L 'Vn'`T 'p0` 'l ' L ', 'a '] 'm  ' X'y@ (+  (7 (+k<  (1 ֈ(8ͬt (PR (\h (g X (r (' (  (0 ( X (uDd (n(*4 ( *X )ۼ )L )&  )5d )K )Y! )d l)ovL ) )*< ) )$ )y( ) )H * X*  L\ *`8 *+FH *< *P, *] *i\ *r-X\ *  *t< *n*,\ * *(x *]T *^l *p +  + Z +1LD +B +S +[ +jn+wn+ + 4+&lD +_L$ + +0$ +  +- ,], , %,T ,x ,%ul8 ,4$ ,<n,D@( ,Q\4 ,\ϰ` ,d, ,x , 1 , p,l ,RP ,$ , , ,T ,V$ -\ -t< -)n-6n-CH  -U  -g@ -yЀ  -H -hX -  -\P -P -L -| -4p - . p. 4|$ .- .-_p$ .B ،.H .Q$@ .b\ .l l.z 4 . . .n. . tL .̈D . u . L .Y /*8< /x /yx /.)l /<@ /PYh /` vL /mh /|P /0 / / 4 /܀  /H /< /Sd 0k\` 0b 0!,t 0.+ 0> L0F 0MӴd 0c 0r 0 0 \0, 0W@ 0%t 0sd 0 04 0 Y4 0i 1P  1$`  1<LL 1W 1c | 1p txL 1|o1N  1Zd 1m< 1* 1< 1 $ 1R 1 41, 10 2 2#4 25 2@ 2X 2ss|4 2}tx0 2~D 2a8 2t< 2.$0 2 `2lH 2 a 2d 34 3)]D, 318 3B`0 3O 3S  3p< 3}(4 3 3'`h 3{ 3 d 3 3 3p 4 4 T 4 T 45 4A T4I4 4\( 4m^pT 4{  4| 4 40 4o4 4 4X 5*XT 5 5"< 55H 5A 5J`Hd 5Xo5fH 5 XH 5 d  5 5O  5 5J$ 5`8 6 6` 6=  6N `T 6X kt 6e ٌ6nT 6}3tl 6 | 6 w4 6vX 6T 6HT 6 6L 7@X 7y  7!N 7: d7J| 7e 7vP 7,l 7_D@ 7,$ 7u 7  7#\ 7(t 7L 7 8 L 84 8-p 8. 8:Ld 8V ״8^v 8m 8 84 8W 8PXx 8+h` 8 8d 8 x8o'89 94 9) @( 96 9F X0 9W  9d 9w H9};d 9X 9o 9  9  9T 94L : d4 :tP :! :(pL :8h :M@:SJ :^j :n : : : : \: h: |P : h : ,:v ; T;< ;%ˠ ;18;:8 ;E0 ;W ;g<;vx ;8 ; t( ;@;4 ;D;&t ;2 ; <H< < D <+H <@lP  >U >!P >1< >E _4 >T$ >aT>mX>|D >0 >c$, > > >\>X ? א? dL ? p ?*  ?;L ?R ?Z`?c  ?r ?@  ?J ?<  ?, ? ?_($ ?ܠ\ ?d? ? @ ˈ\ @0( @- @5 @N @^H @k. @w T @]` @u< @ @8D @ @h@  @lA  A hA2 A/x A=8 AKB8x A_i, Atf A w4d A*t A(< A A( AG0 AaHL B04@ B#P B, BA@ BX< Bc(p By B B ؀BpB ռBK,H B/0 B kld B  BD B0 C LT C+D C7 Z8l CB wD CM#< CZtCf\ C~xC~ C C*| C CLp C C*$ Cp DҼ4 DKl D(B` D6 DT PT D` Dt p p D~3, D ) D`P D D|D@ D Dc` DL E\ E?4 E+.$ E< h< EPP0 E` \$ EkՐ Eu-4 EX!E1$ E E: E E E  EE< ET4 El F$ F< F F1FE( FV Fo) | F504 F FT Fl\ F T F jt F\h F/ G |L G#0 G0 GEr| GS G[\d Gl  p G Gl G p GD GӘ8 G` GP G רGh G eT H HD H,ш H: HTp Hb Hr8 H 0Hh H@ Hh H{H H͠L H0 HDp Im4l Ic I", I1 F I> ʸ IN @IV  Ils I ` I  Ip IP` I Ŝd IT< I[ II 4I'X Jf` J *<D J? JH JUJaȘh JxPX J Jx JeP J v4 Jz  J $J ɸ, J h Kl K8 K8I, KH(\| K]x4 KmNX K}~@ K (KsT K< K0 K KN"Ku4 K-l L$H L*0 L:8\ LG| LU2 Lb" Lv LL`< L  L.p LL L\  LL Lo` L MxH M, M?  MODX MZy Ml0 MOD M 8MT M7l8 M < M  M N8 Nu$ N*l\` N=&0d NM NXI< Nd< Noa`4 N ]@ N xN+  NN' Nx N N` NX| O O_t8 O( O/O<8` OIx O[ Ob <Oi, Os\ O{lH Ox Op Oct4 O O DOT ODx P  PY P$\ P3 ,P< PNd, P]V Pk P'L PD P Ph PMdH Pl PHL Pߔ4 Q q QdH Q/ a0 Q;T QV Z Qgd, Qt( Q}< Q\ Q Q@ Q Q ^PL Q<P Q/( Qd Q8 Q 8 RLx0 R]D( R+x R;1L\ RGY< RRԼ  R_ Rf tR R R8 R R $R$D R7 R Rk RSS xh S/H SG( SWT4 SaL S| jx SŬ SaP S ]| S Sh Sf0 Sl T TTL T;/D TL1d T[t Th$ TvҌx TL( T` Tu T T- Th TO0 TLh T L U L UL U*F U>| UJUO U_ Uf`< Ur @d U U1(< UƼ UT( U< U $d U u U  Vݘ8 V' @ V8| VD' V^]@ Vh^l VzU4 V0t V:H VVD| V ` V4L V W x W&@ WW*ϴ, WB HWJ S WQ  W^ WhL Wu/< Wј4 W 8W&< WWW PW W d WT$ W< X p X X5L  XL XVɨD Xg@ Xz pX XXd, X+  Xd X4T X( X$d Y ذYp< Yc  Y( Y;YCx| YOYWY_< YruP YYx Y YFxx Y , YL Yl Z ZX0 !ZdH Z3ɔ| ZI`@ ZZ Zj@ ZtS( ZZ[#, ZZSl\ Zڰ Z* Z Z ZY( [  [ [   [0P [J  [Y [m [~ [+x [[ [ [ [t [ \ \t \0$ \5$ \C t \[ \vN0T \8 \ \Kl8 \  \6dP \ \ ]@ \x ]x ]#+ ]0]=E  ]U ]i @]t  ]< ]u ]ܔT ]8, ] ]H$ ]Q, ]e  ]8 ^ ^v$ ^+< ^8^E <^Ul ^a0  ^r[| ^$ ^^ `^׌ ^V,0 ^+ ^N"^8 _ _'?(_0 _<< _C\ \ _M _T[0 _b Ƽd _v  _ #@ _ @ _@ _  _.T _ _a _?,_  `tl `*) `= `M `YtH `ad `p `,8  `D `h, `t ` `L ` p `| a0 a  a6  aJx a^  ak rd a a( a?0a h  aӈ a?@a a$ a da b$P b\T b۔( b-8 b=Nx bT'H bj(  b|| b$D b bP bΠ  b b bl bF< cu, c,4 c$0 c:uL  cT cdt csT cd c D cu c cj c c cT d Ϩ d0t d d) tP dCPT dT8 daNd dr d~[T< d dSD d d` dr dTD d e t$ eL e$} e4f@ eD HeP edtt e{tP e?De}L e, e* e e4 p eh  e, fH f fh f.z fB?HfL  ff Dfx fd4 f?Lfth f @fnD f fIL fTl fv g(H g , g0?PgAs  gR < ga. gux g g0  gӄ0 g\  g5 g  g $g $ g?Th0 h$+$ h.?Xh7pt hQ.l h^\ hk h ֬h?\hD| h @ h ht h| hh hˠ, iP@ i!u i0 i8 i?  iO D iWp ixD| i@ i` i` i iT il i h iT i  j < j j#T4 j*x j5_t j?PX jKM(< fst_debug_heap_cell_modesort_this_tallyprolog_errorregex_errorcomposefat_string_outiy_stack_writepl_nethas_flag_diacritics_pread_variableLexEOFUPPER_MATCHmake_io_sequence_tablesymbol_to_idset_rangepropio_lengiy_nv_to_stackfst_IY_ASSERTfquery_fopenINPUT_SEQprefix_iff_suffixmake_btree_heapCH_VECTOR_BLOCK_SIZEclear_label_dataequal_length_relation_psubtract_binary_alphmake_dbliy_print_stacksmake_parse_tableSEQ_BUFlabel_class_orderiy_stack_dropiy_sigma_netshufflewait_for_symlookup_linecfsm_label_lowersideexpand_fstpairinit_io_sequence_tableapply_standard_networkclose_sigmaconcat_fsmdelete_statesqsort_emacs_19_31make_symbol_tally_exportprint_label_and_flag_diacriticinit_dbl_meminterface_terminateREGISTERScfsm_number_to_labelfsm_error_functionlinearbounded_pignoreexecute_stringone_plusPREPARE_FALSE_EOFcfsm_epsilon_symbolnetwork_from_text_filewrite_netsprint_tallyregex_inregex_name_startscan_labelsiy_fs_all1_opadd_propsREAUX_conditional_replaceARC_BLOCKiy_compact_sigmalexicon_inuncond_repl_bidirrecover_sigmaturn_lab_ringcopy_stateNEUTRALLINKINGCHAR_ATTRmake_eqv_label_seqiy_print_listsregex_length_processednegate_netprint_lab_vectoriy_list_funcslexicon_initcfsm_make_symbolfree_listlist_dest_arrayinterface_lex_char_bufferregex_lex_tg_read_from_stringgmtimecontains_no_labelmore_thaninterface_file_namecfsm_is_fstiy_defs_to_stackcallocappend_to_lab_ringdecrement_vectoradd_standard_attributesdecompress_alphabetold_interface_input_filefree_rscfsm_symbol_multichar_ppath_index_countwrite_two_bytespropio_wrapparse_lexiconcrossprod_uplow_leftrightdecode_license_typekleene_plus_fsmsuffix_iff_prefixreport_parse_erroriy_compile_replacestore_in_out_seqLINE_COUNTrestore_functionscopy_listcfsm_symbol_labelcfsm_number_to_symbolcfsm_symbol_setREPEAT_SYMBOLapply_networklabel_sigmapath_to_locationsALL_HEAPSsubtract_from_lab_vectorrenumber_arc_labelsvectorize_netsmake_eqv_partitionget_user_license_typeatoisimple_restrictionpropio_charprint_longest_minimal_string_fsm_fgetccreate_bimachine_parse_tableatolmake_alphnet2nvassure_vector_table_spaceSQ_STRING_ONELONGexactlyintersect_fsmoneside_minusget_dest_statemap_stackfree_io_sequence_tableLABEL_LIMITget_morecfsm_nth_labelsymbol_name_prewindhandle_error_defaultcons_celltop_sort_netignore_alph_fsm_fgetsregex_wrapstrtokbuffer_out_scfsm_remove_arcdef_id_hashfnprint_net_sunvectorize_netfreadstrtolre_yy_current_buffer__yy_ch_bufLEP_local_eps_push_fstiy_new_alphfst_cntxtRE2N_net_from_regex_stringreorder_statesexpand_sigmagetpwuidsigma_disjoint_piy_fs_stack_opstate_prefix_netencoding_keyreset_heapinvert_arcsfree_cs_memappend_string_to_bufferreset_io_sequence_tableOLDEST_WRITE_DATEcur_posread_alias_namecreate_vector_enumeratorintern_literalfat_string_to_bufindirect_cmp_label_fninterface_lex_bufferprint_symbolfsm_putsread_netsinterface_parameterstransition_table_from_netcfsm_freeprint_alph_vector_scleanup_seq_list_fsmreset_apply_context_vectorINDEXheapvfprintflexicon__delete_buffernext_new_statefree_net_and_peripherysym_id_environ_endiy_stackchoose_nets_to_applyREAUX_rs_set_single_epsilonignore_fsmintern_atomic_labellrand48fat_to_thin_escRE2N_create_var_stackreset_lab_enumeratorget_gmt_time_sttest1_tg_net_from_regex_stringLEXICON_PARSE_TABLEfsm_putccopy_arcinitialize_hyper_unitnext_two_bytesregex__flush_buffermemmovetally_heapsymbol_from_in_vectoriy_one_plusprint_net_namehex_char_to_bufstrdupiy_stack_saveiy_edit_propsinterface__scan_bytescond_repl_unidirSOURCE_ATTRfreeing_CDRiy_sourcePROLOG_PARSE_ERRORremovedisplay_read_status_bariy_get_stackpropio__create_bufferconcat_labcfsm_symbol_eq_stringsequence_printFst_IY_LEX_ERRORSarc_allociy_upperinteractive_substituteinitialize_string_bufferlabel_set_valuestart_state_compactedLAB_VECTORheap_itemsspaces_outinterface_lex_consumeiy_fs_2_virt_opDECODE_DATA_fsm_getseliminate_flag_attributeiy_apply_patternsapplic_preprocess_leftrightfst_IY_MINIMIZE_Preport_dateswordinvert_tuplefsm_fgetc_iobslicecfsm_unionexpand_tuple_otherSCRIPT_INFILEcfsm_other_pprint_props_siy_stack_swapmark_reachable_statesyes_or_nolab_betweensuff_iff_prefinit_cs_mem__register_frame_infonumber_to_wordrem_lastcompare_label_freq_symbols_precede_tagscommandsuniversal_languagealign_multiple_sigmasTRANSCRIPT_ATTR_fsm_getciy_add_symbolinit_btree_memdecode_var_labelrenumber_netfree_networkprint_flag_diacritic__flsbufcfsm_next_arcfree_match_tableregister_common_fslast_variablefsm_fgetsset_decoding_fnsprolog_infree_cons_memget_arc_block_GLOBAL_OFFSET_TABLE_fat_char_out_escmake_phantom_stateside_sigmafree_range_vectorLEX_ARRAYend_alphcfsm_set_state_finaladd_array_proptest2_tg_net_from_regex_stringcfsm_the_invalid_symbolexpand_othermake_identity_mapfree_nv_and_netsADDR_LIMITsleepreclaim_lab_vectorset_unput_allowedprolog_nerrscfsm_make_unicode_symbolmake_flag_registerparse_stringprepare_arc_markspath_fsmreduce_eqv_arcsatomic_label_to_idLOWER_BUFpropio__flush_bufferuniversal_identity_relationlab_vector_element_atfree_vectorregex_lex_yylesskleene_plus_lablabel_comparefnclear_labelsiy_print_usagesymbol_to_fsm__ctypedefault_arc_comp_fnlabel_memberpropio__init_bufferold_re_input_filesymbol_from_stringoptional_fsmiy_name_netdblheapptrlast_regexinterface__create_bufferSTATE_HEAPinfo_warningassure_vector_spacePOSTFIXLINKINGCHAR_ATTRflag_attribute_countfprint_fat_string_with_esccfsm_top_arcLOWER_MATCHpath_to_numbers_cmpinterface_decode_quotedlexicon_restartdblheapmaxprint_labelregex__scan_bufferinterface_lex_textabortregex__init_bufferprint_commentcheck_for_negative_or_zerocompact_sigmacopy_non_null_fsmfprintf_fflushmake_networklexicon_rem_lastremove_propdeterminize_basicregex_from_atfilefree_propreorder_arcsregex_lexambiguity_netnetsubstcfsm_symbol_eqinput_buffersigma_differenceiy_print_stackswitch_verboseatom_dest_array_fsm_vfprintflab_exactlyexactly_one_labREAUX_rs_reset_single_epsilonfseekincrement_interface_line_counthex_out_bytewrite_arc_blockget_valueupdate_net_labels_and_sigmavalid_license_typefree_state_and_arcslabel_from_arc_location_standsignalregex_outinforce_singleton_classesfree_btree_memcfsm_set_state_names_smashedfree_net_parse_tablesDECODE_ADDRatexitprint_net_sizetoo_many_aliasesyacc_restartcontainsregex_restartexpand_other_in_alphexitkleene_star_fsmstart_regex_flexinterface_clean_inputlinerandadd_path_version2vector_atfree_sequencecfsm_valid_labelcfsm_epsilon_pfree_alph_itemsiy_stackptriy_print_name_oldmake_lab_ringinitialize_vectorreset_lab_vector_tablefsetposintern_symbol_namelink_and_cleanupcfsm_symbol_lengthsubtract_from_vectorexcluded_symbolscfsm_state_countOTHER_NAMEcreate_lab_enumeratorlexicon_errorCPDR_cond_determ_replaceiy_symsubstrenumber_netsregex_charset_warn_missing_semic_EOF_allowedcreatadjust_alph_sizeSHARE_delete_altchain_arcsintern_tuple_labelstring_to_fsmmake_headerstandardize_sigmasuff_if_prefFINAL_LEXICONepsilon_fsm_padd_symbol_to_parse_tableLABEL_MAPget_hashlexicon_error_cleanupreclaim_lab_vector_tablecommand_parsealign_sigmassubtract_label_alphstd_file_header_pLV_HEAPScfsm_string_symbol_setprint_compacted_netnetwork_to_prolog_filecleanup_fstfree_stackreset_vectorcopy_nv_onlyintern_flag_valuePREFIXLINKINGCHAR_ATTRsigma_star_fsmcfsm_label_refassure_lab_vector_table_spacetolowerpushadd_arcempty_rsiy_twosided_flag_diacriticsfprint_fat_char_with_escFst_IY_RECURSIVE_DEFINEhash_table_sizemallociy_defsubstremove_bracesprint_stack_promptcopy_cell_listnv_appendcfsm_label_symboliy_unlistARC_HEAPpl_symbolreset_lab_vectorfree_objectlabel_fsmcfsm_fsm_sequence_lengthSKIP_DATAupper_sigmasprintfinterface_lex_total_restartmake_string_bufferbinary_labels_add_toSKIP_DATA_Plower_side_idpoppopencfsm_free_fsmprolog__scan_stringprolog__scan_bufferfree_virtual_network_storageprint_promptlabel_from_arc_location_compCHARENCODING_ATTRignore_labvector_sizeignore_internallyfree_cellfree_all_heapsunreduce_eqv_arcsRE2N_create_netstring_array_out_snv_getinterface__scan_bufferfprint_fat_stringputspropio_parsenew_interface_lex_buffernegateiy_can_do_onTAGS_ATTRupper_fsmRE2N_remove_var_stackclean_regexmake_objectget_var_labelsadd_symbol_propline_poscommand_lvalread_semic_as_eoldef_LAST_ERRORSinterface_file_typecontains_fsmsimple_replacementreset_vector_enumeratorread_regex_helpapply_reduced_networkget_eqv_map_from_prop_listadd_pair_entrylower_sigmanetwork_to_text_fileCOMPACTED_ATTRfree_parse_tablelog10print_object_srs_appendmax_label_itemreset_vector_tableprolog__init_bufferclear_all_visit_marks_and_state_client_cellsinteger_to_fstringiy_test_2_oplexicon_parse_initiy_find_stacklab_vect_labsIL_PACKAGEdown_right_bm_arc_comp_fnalph_out_sname_to_atom_idiy_read_networkssigma_unionsublanguage_pmake_nvvFst_IY_VERBOSEstandard_nets_from_streamprolog__switch_to_bufferfwritecfsm_state_numberunvectorize_netsCONS_HEAPset_fsm_fgetspair_statesTEST1_parse_unicode_stringintern_unicode_symbolfputciy_set_variablenext_three_bytesDEF_TABLEcompile_and_replace_selfcfsm_symbol_charnew_intersect_fsmfree_string_buffermake_id_vectcrossproduct_mainsigma_union_dont_copylab_vector_containswait_for_regexcfsm_label_numbercfsm_erase_state_namesset_fsm_fgetcRE2N_copy_varfputspropio_attrmake_alph_itemscons_appendapply_netvector_to_stringfree_nvv_and_nvs_onlynv_mark_versionSHARE_warningPARSE_ERROR_GIVENinit_fsm_memoryiy_fs_1_virt_opnew_symcfsm_init_visit_marksinit_save_functionsreport_progressSHARE_make_shared_arclistsLITERALNAMES_ATTRprog_errorinterface_restart_if_necessarycfsm_the_invalid_labelsequence_out_sLAB_VECTOR_ALLOC_SIZEappend_to_lab_vectorSKIP_BYTESfree_alphpropio__load_buffer_stateSTART_LOClabel_to_binarycfsm_symbol_refcfsm_symbol_char_pnv_insertinit_restore_functionsTEST_nv_to_regsmake_lab_vector_tablefree_lab_enumeratortimecfsm_get_propadd_integer_propdot_to_file_or_to_windowmergesetjmpdeterministic_arc_set_pupdate_hashprolog_lexword_out_sapply_bimach_to_sequencestate_to_state_subnetcreate_parse_tablecompose_fstreset_string_memexpand_quotedprolog_textbt_insertprint_sigma_sREAUX_rs_appendiy_apply_and_printlabel_to_sigmaregex_lex_buf_restartLAB_COUNT_MAXnv_extractprolog_outcfsm_assert_state_numberingset_vector_element_atrs_compair_and_copy_intFILE_ALPHwait_for_confirmfget_inputSAVED_SIGMA_ATTRdecode_var_addrNOT_BINARYprint_io_seq_tablecontains_labsigma_star_fsm_precover_temp_memorydefine_labelLABEL_TABLEcopy_fsmcons_cell_appendFst_IY_INTERACTIVEunambiguous_pregex_lvalpl_finalfst_IY_COMPOSE_FLAG_AS_SPECIALset_net_aritylab_less_thanproductre_lex_total_restartre_lex_infileexact_buffer_out_sfchar_to_fstringfst_IY_NAME_NETSiy_sortapply_patternsGLOBAL_SIGMABIG_ARC_HEAPrmap_netCH_NODE_HEAPprolog_restartupper_fsm_no_compactiy_share_arcscfsm_lower_sidepropio__scan_bytesget_def_uncopiedless_thancopy_propertiesiy_fs_1_opcfsm_add_statenew_strdet_netiy_label_netnat_numberfollowscfsm_make_empty_fsminterface_fake_eolprint_flags_sgetuidiy_1_to_n_opRE2N_get_var_numbersymbol_fsmregex_file_symbol_lengthcontains_setiy_stringifypriority_unioncopy_objectrandom_words_slexicon_lvallexicon_charcfsm_other_symbollabel_remove_fromnew_re_input_filestate_mark_one_pfsm_printfwrite_three_bytesdef_LEX_ERRORSnull_fsm_punion_null_fsmold_minus_fsmnull_fsmsingle_char_sigma_fsmre_nlstrftimeexit_with_errorfreeing_CDR_celllower_fsm_no_compactfsyncvsprintfcopy_fst_contextiy_defineFUNCTION_ATTRprop_val_to_alphSCRIPT_OUTFILEsigma_memberSCRIPT_INFILE_NAMECS_HEAPsave_propsiy_print_netsreset_props_sinspect_netlabel_checkrem_percent_quoteother_thancfsm_unescapifyprint_vcg_netfprint_fat_char_escfree_cell_debugsave_props_sfour_byte_addrpair_symbol_from_stringends_with_labeldisplay_write_status_barrestore_eqv_arcsREAUX_restrict_in_multctxbegin_symsiy_listmap_hashadd_seq_to_netcfsm_read_fsmfree_arc_setadd_string_propsetvbuffclosesubstitute_label_alphCommandClassesepsilon_removeREGISTER_LENgetenvsort_alphsigma_butappend_nvvcfsm_valid_symbolWORD_TO_FILEPOS_MAP_ATTRlabels_to_alphprint_alphabet_sincrement_lab_vectormake_hash_tableswitch_regex_lex_bufferlexicon__load_buffer_stateDET_EPSILONfat_char_outreset_propsinterface_lengequiv_fsm_pfree_heaplab_vector_atbtree_insertremove_escapesmake_eqv_vectordel_hashstrncatprint_storage_infoiy_print_rand_wordscheck_for_flagsregex__scan_bytesiy_fs_2_opiy_print_longest_stringprint_pattern_match_countscfsm_initcfsm_update_sigmasplice_fsmuniversal_relationinterface__scan_stringfree_cell_listDATE_ATTRinterface_lex_yylessone_side_outregex__switch_to_bufferold_re_lex_bufferbetweencompose_null_fstlabel_to_netSTPget_reduced_to_unreduced_maplexicon_wraptwo_byte_labeliy_negateprolog__create_buffercfsm_label_setinit_apply_to_streamfree_alph_vectorword_file_to_fsmdo_unoptimize_arcsmktimeprint_global_labelslex_read_from_stringhelp_headerstrncpyquit_on_fail_erroriy_execute_aliaslab_more_thancfsm_set_dirty_visit_marksiy_cleanup_netwrite_to_out_streamiy_paste_net_labelsdecoding_keyTOOLVERSIONS_ATTRread_lineiy_undefineiy_net_from_a_stackiy_func_strregex__scan_stringfsm_fprintfpush_arcpref_iff_suffcommand_nerrsclear_state_marks_and_client_cellspropio__delete_bufferPE_delete_propword_to_locationsRE2N_TEST_1default_label_ordercopy_fat_stringid_to_flag_attribute_nameremember_to_cleaninterface_debug_clean_lex_bufferFst_IY_NAME_NETSlabel_outobject_print_DYNAMICother_than_labhandle_errorwrite_netNewSequencecfsm_state_final_fsm_putsinterface_debug_clean_buf_stringiy_find_variablelexicon__scan_bytesnetwork_to_textlast_lex_stringedit_standard_attributesDIACRITICS_ATTRSHARE_delete_marked_statesFIRST_FREE_LABELREAUX_uncond_replaceiy_stack_loadcompare_label_freq_symbolslist_lencfsm_set_state_namedef_NAME_NETSshuffle_fsmmake_arcnext_byteskip_var_data_fsm_putcfsm_getsundefine_labelprint_wordsinterface__switch_to_bufferstrncmpcfsm_first_arcparse_unicode_stringinvert_fstfsm_fputsinit_heapRE2N_def_varinit_cons_memsigma_fsmlexicon__switch_to_bufferNETWORKNAME_ATTRoutput_bufferIY_UNICODEERROR_COUNTfree_apply_contextpropio_errorset_fsm_getcharstate_num_less_p_fsm_vprintffst_IY_INTERACTIVEchdirside_universal_pheap_sizecfsm_normal_form_netpriority_union_fst_pairFst_IY_COMPOSE_FLAG_AS_SPECIALkleene_plusregex__load_buffer_statefsm_getccfsm_write_fsmprintfdeterminize_fsmregex__create_buffer__iobfat_strcatcopy_lab_vectoriy_print_aproposregex_file_infocopy_label_nameT_NAMECOPYRIGHT_ATTREQV_VECTOR_ATTRrem_escapesstore_in_a_treeCH_VECTOR_HEAPcfsm_arc_destinationCONTINUE_OR_STOPuncond_replaceadd_new_arcLABEL_IDget_headermake_vector_stateInterfaceLexEOFPARSE_ERRORS_Plexc_regexcfsm_remove_arc_optimizationnet_eqv_classesregex_nerrsreverse_maplast_arcstate_suffix_netprefix_iff_suffix_initialFST_PROMPTLAST_ARC_Pset_fsm_getsfsm_copyrightregex__delete_bufferget_linecfsm_set_propprint_compact_wordsiy_current_stack_namereduce_arcsstrcatcfsm_valid_statestrncasecmprs_set_single_epsilonfgetpospropio_valueiy_single_char_sigma_netprint_solution_treecfsm_label_number_limitfsm_putchardef_COMPOSE_FLAG_AS_SPECIALdef_ASSERTwrite_headeriy_alias_parsset_lab_vector_element_atCOMPOUNDCHAR_ATTRRECODE_KEYset_fsm_getcregex_tg_restart_with_initseqs_to_netwrite_arcs_and_statesmake_io_sequencecompose_apply_networksoptionalset_fsm_fprintfcommon_fat_string_pbyte_block_outiy_zero_plusprolog_lvalinterface_textrepeat_fsmconcatenate_vectorsoptimize_labelsfst_IY_LEX_ERRORSnew_interface_input_fileCFSM_LOWERSIDE_SYMBOLapply_bimach_to_stringreallocinit_state_manageralloc_statealph_to_prop_valinterface__init_bufferstrpbrkNET_HEAPstore_in_tableprint_nth_wordremove_duplicatesarc_vector_sizeFst_IY_MINIMIZE_Pzero_plusfree_headerlower_fsmexactly_one_OLDSTACKprint_this_tallyOPERATION_ATTRfsm_read_rcfilelabel_set_value_ppendingdefault_symbol_id_cmp_fnwrite_to_buffer_fsm_getchardef_value_pfour_byte_datamake_tally_sigmacfsm_state_visit_markOTHERup_left_bm_arc_comp_fnat_most_one_labpropio_nerrsdef_QUIT_ON_FAILOUT_STREAMFst_IY_QUIT_ON_FAILtempnamiy_stack_rotateiy_print_namelabel_augmentconditional_replacedecrement_lab_vectorassure_lab_vector_spaceSameObjectsInSequenceprolog_wrapcfsm_minimizeSTANDARD_ATTRIBUTE_VALUESprint_pathsrs_left_rightuniversal_equal_length_relationundefine_label_setpl_startnew_re_string_bufferilex_read_after_definerm_escapesappend_char_to_buffersigmamax_label_componentfdopenFIRST_ENTRY_exitstart_state_standarddbl_longer_pPE_check_rangevirtual_arc_setinterface_restarterror_bufferinterface_lex_read_from_stringflag_actionprint_timeprint_propfree_nv_onlyprolog_charfour_byte_absolute_addrnetcfsm_label_arityNIL_NAMEprolog_total_restartget_file_typedestination_from_arc_compiy_do_word_to_numbersiy_stack_lengthNV_select_copy_netssymsubstthin_to_fatvectorize_netCONSOLE_WINDOW_ACTUAL_COLUMNStally_pathsfst_IY_QUIT_ON_FAILminus_fsmhandle_warningprint_labels_siy_find_aliasfree_propsSQ_FINAL_STRINGS_ARCSmore_inputlineSYMBOL_TALLYinit_lab_vectorfree_range_mapsigma_intersectPLB_paste_net_labelsdef_id_comparefnpropio__scan_stringfree_hash_tablestring_outnet_substsuffix_iff_prefix_finalenvironinit_def_tableperrorprint_dot_netsrandexpand_nvmerge_to_buffererrnoprint_netadd_binary_alphmake_nvinit_apply_contextnegate_labreset_io_sequenceSCRIPT_OUTFILE_NAMEincrement_vectortransition_table_to_fileiy_net_to_stacknot_applicable_to_virtual_netone_linerwait_for_commandnext_vector_elementinit_apply_to_stringPE_menufree_io_sequenceiy_stack_totopget_bimachine_parse_tableiy_m_to_n_opREAUX_rs_upper_lowerdecode_quotedEPSILONcfsm_find_symbolverify_bimachine_flagsLISP_PACKAGEencode_license_typemake_statehas_arc_piy_ambclassnetwork_from_lexc_fileput_hashstrchrmerge_fsmPE_modify_propstart_loops_pdown_left_bm_arc_comp_fnmake_fstlabelregex_cl_length_processedcopy_alphabetfree_arc_vectorvectorize_net_OLDpcloselex_add_propfree_label_table_fsm_fputscfsm_symbol_set_sizeiy_do_number_to_wordsigma_augmentapply_mixed_networknext_lab_vector_elementflag_testadd_label_alphobject_out_sfsm_config_initfreopenfree_shared_arc_listscfsm_fsm_sequence_refint_outdef_VERBOSEmake_default_contextprecedesget_labels_from_prop_listvector_element_atmap_heappropio_textfreevcg_to_file_or_to_windowreclaim_cellrs_handle_int_comparison_erroradd_wordinterface_inprolog_lenglexicon__create_bufferprint_std_file_header_sregex_tg_restartcfsm_fsm_propslab_ring_element_atNewObjectcfsm_unset_propCS_HASHdead_state_pPE_print_proppossibly_already_optimized_pnetworks_from_prolog_filenet_from_atfileprolog__flush_bufferfree_string_memfat_char_to_bufcfsm_label_uppersidegetscfsm_symbol_numberiy_compose_apply_and_printmake_sublex_nametally_stacksUPPER_SEQcfsm_next_stateiy_stack_load_from_streamcompare_label_freqfour_byte_labelNV_fst_checkbegin_lexiconright_marginiy_print_eqv_labelsiy_print_briefpropio_eofdecode_var_datamake_sequencefree_cons_cellfstring_to_charcodeunion_fsmfat_to_thinOLD_reverse_lab_vectorfst_IY_RECURSIVE_DEFINEreal_networks_to_filenetworks_from_filedef_INTERACTIVEhex_to_bufnetwork_to_streamiy_tally_sigma_by_wordsfat_string_to_buf_escCH_NODE_BLOCK_SIZEcomplement_sideunmake_vector_stateinit_apply_netFst_IY_LAST_ERRORSflag_value_countiy_stack_to_defscfsm_set_start_statereverse_lab_vectorcopy_net_vectornv_reversefat_charcmpalph_orderTEST_net_to_regfat_string_out_escfgetciy_change_stackDEST_ADDRiy_stack_reversecfsm_arc_labelappend_to_vectornetwork_from_streamadd_path__deregister_frame_infokleene_star_labnv_addlexicon_textpref_if_suffmake_vector_tablestrcmpsystemget_fieldfree_csintern_unicodecfsm_escapifyassure_io_sequence_table_spacefree_lab_vectorREAUX_rs_left_rightfgetsprint_uncompacted_netrelease_fsm_memoryiy_reset_propsnegate_fsmiy_print_wordsLexPropscfsm_symbol_tag_preset_lab_ringsubtract_alphmulti_char_sigma_fsmprolog__load_buffer_statemark_lengthdefault_alph_orderstate_mark_zero_pfprint_fat_charstart_flexlexicon__init_buffernext_four_bytesSetSequenceLenfree_default_contextPE_add_prophas_flag_diacritics_side_preset_out_bufferiy_add_propsnum_arcsset_fsm_printfintersect_pname_networkupper_idstop_regexsymbol_outiy_find_funcdbl_spliceprune_sigmaget_gmt_timemake_ch_nodenext_arc_location_componeside_minus_fsmmake_symbol_mapregex_parsecell_allocsever_states_edata_PROCEDURE_LINKAGE_TABLE_set_header_file_namefopeniy_add_propbinary_to_labelmemsetintern_charthin_to_temp_fatiy_net_to_text_filelab_vector_sizeinterface_file_infoEPSILON_NAMEremove_percentrs_reset_single_epsilonapply_netvectorintersectdestination_from_arc_standprint_prop_namesiy_labsubstget_lower_arraychar_outtransition_table_from_streamiy_list_aliasescount_symbols_in_ringget_numberadd_character_propregex_lenginterface__load_buffer_statedefine_label_setiy_stack_clearwait_for_EOLone_byte_addriy_eliminate_flagstarts_withread_filecfsm_the_invalid_stateiy_tabularadd_list_propiy_lowerRE2N_var_netnext_arc_location_standmake_byte_blockwait_for_ENDcopy_nv_and_netsfat_char_to_buf_eschash_fatstrTEMPprint_file_infostrcpyreset_stackpropio__switch_to_bufferFAT_OTHERiy_top_stacklexicon__scan_buffertally_heapsprint_string_bufferdelete_state_from_listadd_props_sflush_get_input_bufferid_to_flag_value_nameget_unreduce_keyread_headerfree_nvv_and_nvs_and_netsadd_labelpriority_union_nvnet_unionlabel_set_net_pmake_vector_state_from_reducedARC_VECTOR_HEAPfat_to_thin_nameget_match_tablethree_byte_addrfst_IY_VERBOSEconvert_twol_netsnv_to_nvvregex_textiy_multi_char_sigma_netDBLheap_etext_lib_versionpropio_iniy_save_funcfree_dbl_memstarts_with_labelfflushfree_nvv_onlylast_commandDECODE_LABELCHARNAMES_ATTRbegin_lexiconssubstitute_symbol_alphminusprint_states_scomplete_fsmreset_pattern_match_countsfree_vector_enumeratorone_regexinit_label_tableintersect_null_fsmLANGUAGE_ATTRMATCH_TABLESQ_INTERN_STRINGS_ARCSfree_state_managermake_cons_heapinterface_expand_quotedmake_pair_labelmake_rsrepeat_labelmemcmpprune_fsmlab_vect_lenVERSIONSTRING_ATTRfs_arg1make_vectorfs_arg2fs_arg3uncond_repl_unidircfsm_number_the_statesfs_arg4other_in_alph_papplic_preprocess_uplowvectorize_dense_states_of_netfresh_line_sconcat_labelat_most_one_OLDcfsm_error_object_ctypeinterface__delete_bufferlexicon__flush_bufferlabel_componentsskip_four_bytesgoto_linemake_connectedCURRENT_FILE_NAMEinterface_lexold_regex_finfo_ptrlenient_composeiy_print_defsadd_propcrossproduct_fstEPSfree_list_sizeget_last_headeriy_save_aliasdisjoint_arcs_pprint_net_flag_diacriticsdecompress_netfree_included_tableVECTORIZE_N_ATTRfst_IY_LAST_ERRORSiy_check_argsCFSM_UPPERSIDE_SYMBOLset_fsm_putsinterface_outup_right_bm_arc_comp_fnmark_toolversionadd_simple_entryALTCHAIN_SYMBOLflag_diacritic_name_pmainprint_path_fnextract_compile_replaceregex_restart_if_necessaryfprint_fat_string_escepsilon_fsmTYPE_ATTRfat_strlenREAUX_crossprod_uplow_leftrightfat_strcmp_labregex_tg_flush_buffernet_name_outextend_net_with_labelintern_symbolprolog_parselexicon_lengRST_restrict_in_multctxinterface_file_lineBTREE_HEAPset_fsm_putclexicon__scan_stringcfsm_state_nameid_tag_pinit_io_sequencemake_range_maprestart_fstRE2N_save_varfind_pair_statenetworks_to_prolog_filecreate_stackcfsm_add_arclabel_hashfnDEST_FINAL_PCOPYRIGHT_OWNERiy_fs_applyfsm_to_word_filetally_labelspath_to_numberspropio_lval__filbufNV_select_non_null_netsinterface_yacc_lex__change_token_for_definereset_labelLOWER_SEQSHARE_clear_deletemarksprolog_file_infoWORD_BUFnext_symbolpl_archeap_infomemcpyignore_labelsfree_reduced_to_unreduced_mapcfsm_valid_arcstate_label_outget_unreduced_labelslower_iddef_RECURSIVE_DEFINEfree_consstrlenfree_upper_arrayTEMP_OTHERintern_flag_attributecfsm_fat_symbol_nameprolog__scan_bytesKEYWORD_PACKAGESTATUS_ATTRmin_fsminterface_wrapiy_unreduce_labelsetconsprepare_state_marksintern_intchange_lex_state_to_REGEXPSTANDARD_ATTRIBUTESmake_outchar_vecteqv_classesinterface__flush_buffersubstitute_symbolunicode_string_to_fsmpropio__scan_bufferget_arcs_and_statesclear_cs_memReduceSequenceOfSameObjectsnv_pushapply_bimachinesave_functionspropio_lexexactly_oneSTATE_NAMEstrstrwait_for_confirm2localtimeset_fsm_fputsfree_nets_onlyiy_undef_allNV_2_nets_to_nvfree_byte_blockis_character_printableprolog__delete_buffernew_re_lex_bufferrename_statesrecover_regex_errorlexicon_outword_to_numbersiy_reduce_labelsetpropio_outNEWSTATESignore_intern_fsmrs_upper_lowercfsm_state_listread_bar_commandiy_stack_push_definedcfsm_set_state_visit_markget_parse_tablecontains_label_fsm_putcharwait_for_parameterpropio_restartcfsm_start_stateregex_fake_eolconcatenate_lab_vectorscontains_allsym_substwrite_four_bytes_finiiy_stack_popreset_solution_treefree_apply_context_vectormake_alph_vectorcheck_headerexecute_commandslexicon_lexread_or_takeINTERACTIVE_PRE2N_remove_varFOPEN_ERRORset_fsm_putcharoccurs_as_label_component_pread_regex_immediate_actionread_parametersends_withiy_print_netcfsm_make_labelmake_lab_vectorAUTHOR_ATTRprepare_visit_markscfsm_read_fsm_sequenceupdate_match_tablescommand_charcfsm_make_fst_labelprint_a_promptrem_firstat_most_onenot_enough_memoryend_lexiconsfsm_getcharwrite_byteDUMMY_LABELread_regex_post_actioncfsm_label_set_sizeWORD_FILEinterface_last_lex_stringNOT_INITIALIZED_Piy_print_helpreclaim_lab_ringUPPER_BUFinterface_remove_percentFSM_MODEprint_lab_vector_tableSPACE_SYMBOLfat_strcpyreverse_fsmcfsm_the_invalid_arciy_set_stackdelete_eqv_arcsLEXICON_LINE_NUMcfsm_get_contextio_sequence_atadd_byte_block_propexpand_nvvfprintfflag_attribute_occurs_in_psubstitute_labelno_alphfat_strcmpsymbol_from_streamLEX_COUNTcfsm_upper_sidecfsm_context_objectcreate_apply_context_vectordef_valuenew_arcsflag_diacritics_two_sidediy_stack_dupsigma_add_toupdate_label_alphabetlongjmplexicon_nerrsvectorize_dense_states_of_net_OLDupper_side_idBOUNDARY_SYMBOLcopy_headersubstring_fsmignore_labelclear_client_cellsrm_mult_escapescfsm_arc_countvprintfisattyvirtual_final_phex_outrecursive_compose_apply_networksrevmap_stackmax_binary_itempeeksigma_remove_fromSIGMA_ATTRkleene_staradd_regex_entrycfsm_symbol_nametwo_byte_addrlongest_minimal_stringcfsm_pruneread_first_netconcatstack_sizeindex_netend_lexiconcharcode_to_fstringlibc.so.1SUNW_0.7libm.so.1libc.so.1j_ =(ji l3 pXX0q դ հ ռX  3 %   4   ( 4 @ L. X dU p |. ֈ ֔{ ֠ ֬ ָ   \ /     $_ 0 <& H Tp `  l x ׄ א לj ר ״ ! B  S  x  b + , 8 D. P \4 h@ t ؀V ،  ؘ[ ؤ  ذ ؼ     J l    ( 4K @r L X d p | @D# @s#@ @, @ ֖"@@@㿐/ㄐ @# @   $?@`  `` @   "㿐㿐/ʮ ``  @ 㿐㿐{s!c@0 ss#Д#!s#c@4t@0`t@+` t@&at@"at@at@bt@b@t@bpt@ bt@ ct@c8t@cu@`(㿈@s  v v""T"v/|-"\ ;uv9u7u"PT, $#u`P@T@ "@@N`X "@@H ` " @@Bh  `Pu@,@ @= p`P@2@ '@6%@,@1@@2 @2@u@1`T 6.  % @T 6.u@`@!% @@ ` u@6@%`"% u,`@@  u@` `@r@@ߐ?@#r"` @@a u&@z dh@@ْa 2@@Ɛ @Вh  u@6 @ ,@x@ O@@a 2@@T@`X u6@',`@ '%`@% 0%`@@a  uv% ""P@i< $@@a u%`% @@a( uuu08@@ 2 @q @@a@@k?T㿈@R!v'"\"!5{b# {c$/{0#<-{&#{%{'{){+{%%#$c$$%#@j%c@@+&@+@ @]W   { "bԐ#  @G v"P`%}  '%u @< '#}!u`X@8" @6@uubH@8u@,"p}@, (    (v$vuc!@@! !!  2@yא @%a @ cl @c@ vb\ `u"@c@y @&v"v"v"v"|v"v"\v"`v"v"㿐@_@}@Ґ (㿐vbT 2 u@Q@}@Đ (!@c@㿐vb " u@=@β}@ (!@c@k㿐{  \ `",{ N  L " @@L@  `L@   "!  2{  T \ 2`@ @K@m$@  㿐{ @@U @"S #'+-%)@+` @   2倊 2 0#@` `  @%ฐ@`Ѐ @" @@!  @ !  @!@  `@@ @԰ 㿐{!Ԁ "5@ 0``  vb\`8  `4@ @D 0# 0 #@-aX@j@艐{!ؐ @7@ap@~E0@͐!v@D>b㿐{`3!Ѐ@0`%.`{v`\{* |`%"@자 `@ @엒@`0@썐 8  @ޒ`@ O{a  @x!@ @@)aԛ,`! `@ @1@aԀ@*#,{v`\* |%Ѐ`%a@L `@ @E@`0@; 80 @`@㿐`{!@`.@9aؠ "@@vb\ x   a@耢 b\@C 4b\ @`?@0@v@Cb0 v"\ `#@La@Cu 4㿐!{!  v"|`&#@8a!   v"|` #@&b !@@! ""|`#@bX 㿐{ 2 v"|`#@뾐"0 ?2  : @ -`!Ԓ@~M!Ԡ%@@~H!ԙ,```@"  "@㿐{ !`@됔 * {\(* {\(㿐. {`\* `2"#@c㿐 !{!`@}S!"@@}g   v"|`@0c㿐 ? %v , @#{a`@}, a"@@}@   ? 2 \ `{#^@~_ 4 * {\( "  @6  *`{ { {{І\* (㿐 &. {v`\{* |{#!Ѐ`"@ϐ `@ @Ȓ@`0@꾐 8  `@@ 㿐{a   #@``  #@`x  㿐{ ' \  @ߤ @~!㿐@d+ `1{!` "@}X!"@v@Ab 㿐@cא `1{!` "@}=!"@v@Ab 㿐{a 0 v"\ `#@b@A 4㿐= !{!@|!`2 @}g!"v@Ab @s㿐 #!{. !`@ !`@{!"@@|    v"|`@/+c㿐 !{!@|!` @}!"v@ALb !{!`@{ !"@@{ѐ 㿐@  {. !ԅ.`` " "㿐 !{ !@|X!`2 @|!"v@A b 㿈@@S "@) !{!`@{l! "@@{0 b@#v@@b㿐l { !@{㿐{!@$v"\T Ԓ @{`2 @|a"@@4 @r,a`㿐{! 2 v"|`@#"0  @  +` `  " ?@&ԗ+` "@ {؀ ?㺠۲@? `"cD Ȣ  "ج^. ? M5% : c  @Đ" ΰ @贐@貐Ȱ  c 4 . * * ?`#.`   *`  ?`#`   *` ?@  ,`?!R = D?D@ &DD`aі  &D*`"R ! "<$, !R @ ! R ? !yID ?&D۪``b%@l"6R `,  PR ' "* @?`*`" @3!1!4/!5@ @+!+0)(!2!p@*0"!!0!*@{{! {{a!1@"0  !!@װ!.0@!/0 @)!q0@(!3!7!a!u!֔ c԰!@ 0@(@n/ X@ܒcg/ v"`!#"@В@[?  , @!!Q/ N!,@J@ @ `d"`d" >;#@@7@ @ "@繒b8} &"``!@箐"@0 "P@琒c/ @^@@X@ "#@P@"#@@`X@v"@8@ #"p@, @͐ " |"|"@ @` "@-?Ĩc @&@&`/ @#/ @#/ @$./ @#/ @ x"/ a@ r / _@ l H/ @ f" / @;/ @"cd#0bd{"&x!u#|r#P*o pl!pi!@"cc` ]#Z"@W"hT"t@"cNK!H"E!p@"c?#0a8")5!T2#d/ @b@ `@O/ @a""-#|" "$# "c"#"c" B"pG!": \#`?#2#Wި!Hۨ#\Wب ϒ ԓ/  ϓ/ ˓/  Ǔ/ Ó/ S/ u/  /  @'/ @'Z@'/  / @'d / @(L@@/  "@$@#8/  / @%`"/ @0`zvŐ#8x0`qa@ 7!00`ja@ 0!P0 d/ 0 ]/ :P W/ @ޔ 0 O/ @֔ 0 G/ @Δ 0} > @a0u 6 @Y0m . @Q0e '/ @0] / @# 0V@/   *  @@@cc/  /   `@03            ި ܨ ڨ  @@=@@*@Ψ ɨh5 L h Lx L x L  !<  !< @@/ !< @ / !< @ / @ @c |v@y"b@}@v/ @@r/ vn"`vk"vh"ve"vb"v_"v\"hvY"vV"vS"vP"vM"vJ"vG"vD"vA"v>"pv;"v8"xv5"tv2"|v/"   @@'/ v@"|` 0v@"" 2`*`6 2 "   @/ v@%&|/ @V@% {{!@U"`{{a@]"@$ v"\`  @$ؓ/ #@cѓ/ @@͓/  ɓ/ @%@_Ó/ @#Ғ / @k@#ː/ @@/ @@%ՠ @%@@$8{{ 8`" !6 @ !{ {!{""Ȑ"b@$"@$"@7#`|/ ?x" '{#{%{$Ȑ$b${ '{!#{%{`$$b$@R{ @{$b$@$Y/ @&,U/ @&cP/ @Dc!#Ԓc@ #@ ` @/ #@&@0/ @@'+ (/  # H  H@㞐 / @`P# x@Y @&&cv@:b/ @R/ %@ "j/ R `?,% *`%@UR  b< ,`!R @ ?,! uR ?,!**`oR ` `ؐ `@:"؀`  D 8?&D3U,`?R  "<􀥀, !R `퀥! R   ߀!y۪`b2%@  @@   ` @@ 55555E>8>P>h>x>>>>??0?L?d????@@$@D@`@p@B@@@AA AAA$A,A4A<ADALATA\HAdAlAAAAAB B(BPBxBBBBBCCC C,C8CDCPC\ChCtCCCCCCCCCCCDDDD D4DXHDDEEEEEEFlFFFHFGGlG|G|GGHHhHHH㿐v7{"\+{53#)!/-|1Ԁ b 2%b{ja%b&@&` !69!р!,|7`T4|@  @ "! !@  @@!@ c @!@@c \a%T@Ḓc%T@PD`T  @    $ G @  @@!@c @!@@c $)$T ~$T@  @@!@Ɛc @!@@c 2 $T@ @8Րh㻐# a @u/v b\ ,  @O {$\a䀢 J  @P'{@O@7@O @< !O  0 @" @֖`1 K ;", @d/@P+ ${a$ "a쀤` {#b  "@M7%!@Op'0.@!v x, ! ?4! x,< ! ?*! x,\ ! ? ! x,|  ?!j x,  ? !, x,  ?!% x,ܖ  ?! x,  ?!C x,  ?!1 x,<  ?ڰ!D x,\  ?а!E x,|  ?ư!d x,  ?! x,  ?! x,ܖ  ?! x,  ?! y,  ?! y,<  ?!K y,\  ?!: y,|  ?v!k y,  ?l!. y,  ?b!> y,ܖ  ?X!G y,  ?N!F y,  ?D!e y,<  ?:!/ y,\ ! ?0!O y,| ! ?&!z y, ! ?!| y, ! ?! y,ܖ ! ?!~ y, ! ?!P y, ! ?!Q y,< ! ?!{ y,\ ! ?!} y,|  ?ְ! y, ! ?̰!3 y,  ?°!o y,ܖ ! `!q$@%!$%`X% `,,` y,  ?!L y,  ?!\ y,<  ?! y,\ ! ?! y,|  ?~! y,  ?t! y,  ?j!c y,ܖ = ?! y,  ?! z, = ?! z,< = ?! z,\ = ?y! z,| = ?o! z, = ?e! z, = ?[! z,ܖ = ?Q! z, = ?G! z, = ?=! z,< # ?3! z,\ = ?)! z,| = ?! z, = ?! z, = ? ! z,ܖ = ?!$@%!$%`X% ,,%!# {& z,  ?! z,  ?! z,<  ?! z,\  ?! z,|  ?! z,  ?y! z,  ?o! z,ܖ  ?e! z,  ?[! z,  ?Q! z,<  ?G! z,\  ?=! z,|  ?3! z,  ?)! z,  ?! z,ܖ  ?! z,  ? ! {,  ?!А$@%!$%`X% ,,%!##&{ cԐ "`&{"b !`X@ ! , $@ %%!%`X ,,%!! , $@ %%!%`X ,,%!!!!!)!(!'!`X @ ! 0y`X @ ! 0t`X @ !0o`X@ ! 0k & & & !"   !!  !#  ! , ?$@%!$%`X% ,,%!G& !$, ?$@%!$%`X% ,,8%!k!{ !0"bc! , $@ %%!%`X ,,%! /f&!4!!{b"!,{"Ԁ`@ؐ"{ !-"b )!& )!& )t&{"Ԁ` {b"@!`@׹"!`  "`"ݰ!`  "`հ!"@מc{!#`"{ !"b !!!!!!${ !"b , $@ %%!%`X ,,%!! , $@ %%!%`X ,,%!! , $@ %%!%`X ,,%!! , $@ %%!%`X ,,%!{! {@ q {@"{`X/{ $,? $  3 { &`b# $# ` ! `X@%!@b`X D@!  %!@, " 1   {$ &{~$ @ 5&  ?`X2   @ : %!Ք  j{{@be{`X@%!`X @i! `@ @%!`X @!@L"J{^8^T^|^^^__D_l___` `4`\```aaDalaaab b4b\bbbccDclcccd d4d\dddde$eLeteeeff<fdfffgg,gTg|ggghhDhlhhhi i4i\iiiij$jLjtjjjkk<kdkkkll,lTl|lllmmDmmmnn,nTn|nnnooDolooop p4p\ppppq$qxqqqrr@rhrrrss0sXsssst \xtttuyDu8xu@uHuPuXu`uhu|uuyuuuuuuvvHvv\xvv\xvvyD\xwPw`wpwx\xwwwx,xHx\x\xdxlxtx|xx\xxxyyDyxyyxtxxxwxxxxxxxxxxxxxxxxxvvvxxw|w|w`㿐{{!  ` ! X@L#( ` {X" "   X" ?` .  `$ 2` % |"`"? )+  "  *` 4& 2`@&  `@ & &   @c`  "@ $4` 4  *'{@? "@@ա `  "`  `*  `* 2% {" ` @Đ#% `!{ @w"  % " ` @# "`  {" @  { @b " $  % * `  * `%X㿐{1{X5{ !@H13  ∔a(!I ( .T$ #``R@ (T#؞ذ`!(.R..`Q(VR@ ( T@㿐 .` 1{P! Ͷ(W@(V ؂؅.`Qh/ .` W@(S!(V∄(Ph 㿐{{a   ,a` ##`  `     *a`8" ` `   @ "`@ɐ#?,$`X ,$㿐{  a*aK 3 {` #(+ `X#F$!   ! !{@b@N ? `{{@b{`X$!! *!$! ,㿐` @J 1 J + @Y ( 2@c { & @& & & & && & & & $` { `*`" " @ " 㿐{ /"a!2  XK `1K   "  J 1  ``2K* * KJ @  "*K   㿐  {"` "!{{"!{! {@N$!@v!@5! p" p"c"" p" " " 㿐@c!& { (& & "@" 2 @#А @& &@#Р @>&{!  { `*`a" " @&a" a & & & 㿐{a `  $   $a@|@za  { `*`a" " @$a "`# " $# "$#@$#㿐 { b""  瀣 m{cП`#@қa @Β " @? " @  `@ҽ@ҷ`9{b%{? "b@Ґ "? ?4&` 5$!2Ia#@W @c0=@ґ`  {"Ԓ#".@ 0){ bԐ?"b&`&` &`"  N 2 @{a &@ &`&`#@`@?㿐{a # { *@!" " cД"!`8 "`#ɒa@*!`@U"`!  ?c?# '@'  @'ǐ@۴# $+a@!`@-@ c` {""` " `"""`7!{?#L@ 1 @ &    J@ <    `J@   < ?#L@@`  J " J   ?&@>4! @=`. @="`.  `??#@;@0 '{"@ @?'?c?# @ @ј@@ k{! "g  b#`^` [@ V@@4 #@  $ca@[!`@ц    @*?    "  )" + `@* `  ?# *`"  {"`""{"a" X  * #@a0#@ڒa㿐`.{3{""`a# `"p W R!{"""a@a "@&aa@!{@#{{{""c̟ 怠 "@ `$"ԔJ 2 @     $@& @$(  { `*`" " @d$ "`#`{"`"J` "#{ $a#%${{$!{* a*a"#b$` $X +@;O$!㿐!{! {@6$!!@^@㿐{  { `*`" " @  "`㿐{;7{5{9'`&&#X/ 㿐@ ( 2`@#А`@& & @#Д @& 㿐 {a""a  @u @s㿐@ &` & @`   & &  { "((!"""${{"  "a# X @*㿐  `N 2`@㿐`@!  @+ 0 @@ , `@& *, 2 @ ` &`㿐@t㿐@Β㿐@r㿐`@Z#@F 㿐{ "!!@ 㿐#{"b!{@π! b>$!!f%!{{{""c̟ @ $"ԁ{  {  { ) { % 㿐{ 9"a"㿐{ ;"a"㿐{ {"!!@ 㿐{ { +"n"㿐!{ -g$! d$!!#`?㿐 {Z"!`X㿐 #{ $"? 6"  )'@X, &   <$a!#А 6$a!`X"@&㿐{ 3%"a!  #X@ J "*X㿐 X J { "b㿐!{ /$! 7$!{ # ""{ 㿐  @j? %LX?:L㿐  `  /, {В@  !( !@㿐@.c #@!` ?:*㿐{b   #{b"2${"Ԁ`@+"!{! b$!!%$㿐{{""cП` #` `@!H {#` ` " ` {@ b{@bװ 0@;   " 㿐`@ͩ#@͕? 㿐9; X7{`. X@&@/`.@#Ё㿐! !0!{ /"aX 㿐` @ؐ "`?㿐֠  1 `Д%*" @          #b @G `1 Д%*! @          #@%b  .  $,4<DLTTTTTTTTTTTTTTTTTTTTTTTTTT$,4<DL㿐  1 & &J  ` 8 9@ ?J@?В[@ + $J@! #bH*@̤@̠bx*@ 㿐'D `" #@̍bD`'Db ` \2Z,  x֘1  `D  ` DD `,'DD1J  ` 8 9@  DD ,`2/ .D 'D *! @ , , , ,  , , ,D , D  'DD  "2 D,  `"'D #@b (444444444444444㿐'D `" #@bD`'D ` \2,  u+֘1  `"&D  `"!D  `"D  `"D^,D Y D `,n'D ? 2k i?D  xD 1 @ D  `D,9 D `,N'DL 1J  ` 8 9@  D,D  `6,4 `,'D `? *! @ , , , ,  , , ,D , D  'DD  @,`'D D  "2d D, ,  `"'D #@<b tPh,\8D`  %"  *  `ࠄ"4* 㿐`  cs v/ch v@"b01@\Р  n, ` "@ @^M ߾0@\ @W "@ߵ x@!o# #@{,v@"fb㿐! #) A#Ԑ  ~ :" : \#`)  D+-v)@@z#@  @]^@]Z 2`@zc\`8  @""`40 #@zc0v@"b㿐% $`@@4 2@ @  @!Ԓ`0'`0  !#`@zϐ@z˒a@ggb@$`l@ה@c@ {v@!b00@7Dc㿐vb\ L  `@ӗ " @! 4  *`@ `Ā "` `@7 " @! 4 @.  @@.20 @˒c㿐ޛ v v "\  `   t p   T"`("`"`"`"`"`8"`@"` "`0"`4"`, `2 `#@zDa8@!m 40` @Ќ "\@!c`4` #@z/a0$#@z'bH02$  $ q`  c&l&d@#@, `@̘`!`N@ `1{@8v%0@֤"Ԁ @y@j@8f `7`@֍`0 @]b @ɖb b@yӐ#"\@ `40*"`@ւ @;` "\@ `4"`@v``,  @w0 "\ `#@)b@  4x̐ `v [v%{ b\0`t `p`$ $ $ $ $ @5 P$ $0`  `?ࠀ` " N@  -ࠀ   7 7 %@7א%#b@y] @7Ȑ$   ڒؠ @֣$ v"\ `#@ȸb@ ` 4p'c0'@Ȧ7怢   @Ȟc8   `#"?v#\b\`t`<#` @##d @s@xb@ȍv"\ `#@rb@  4㿈'"c'7 ``` vb\`8  `4@ @  0`.`!  @@ @c @x#FD! !#cP@x@xc0v"\`  "\@"\ l` @?# H @S@0ѐ@ y0͐ H@F 0ǐ H@ 0@ϐ H @ H@ 0@iP!|@j@"$" H@ 0@#@x[c0@  H@xR0@ؒ ?@ @F   @@  @i @s$@ǿ7p'V    @`(@x   @4@r 0 @l @x 0N@x vb\`8 G@,`40CV !v"\ p@Ԕ `(@w"\ p@Ȕ @w``0&v"\`"\@ސ"\ @ 0v"\`"\@ː"\ @߯ 8\pLpp`U @@ @@@w 0V@鍐`(a  2!!v! v"\`p````< `t#\#`#d#h@m#l````< `t#\#`#d#h@[#l`쀢!#cP@wV@wR`0 v"\ `#@Ȓb@p 4㿀!  #2 ?#Ԑ  ه 8av! "\ p`t  < tȒ #\#`@9#d`b  < t #`#d@)#\`!#a @w@v`0v@$b㿐& `C`    @@ƨb@@[b &`"@@Ɛb  "%8a@ƃ!@Ʈ  @a#@v v@b0#_" 9@@vb3`H_ H   @v"@v"H@v"a 2@v""2@vz" "2@vq"@vn!`H a "ş W| T`ڴ P"@O L""@逦` {@""` ` "`{# b " "#{ bL " @@YX `  "`  @Y+ bL@X$bL v@Wb`"#`  "%a@Ӑ!@"  @@vc @͐  ,  㿐. @XT 2 c@v6#0%v@ @ c@v'#@v@ڐ a ( a!#cp@uؐ@uԒcv@b0ia!0[`  @E  @  | "`  *@*` R` $`    ` 2  ` "  *c#@uݒ`@uא @uѐ 0 ` 8@uȒc値``c `@uv@b?@?@@00  @W0v@b㿐!`@# )!#%|"@א$!@u>$cc` #!@f  㴀  b`@Y L㴀  %#$#b@!| $#@@q#@#0 @u v@Lb0v@Hb㿈 0!##`/-+@u)%|'@u`@u@Ġa  @-h $Đ$ @?Б* :  * @€@e0@0@R0@$0 @tݒa80؁ČHT`l㿐#c @R  |"䀤 @o     @x@U#v@U#v!#bH@t, @|2 @tb0b\@`4b\ 0`@6 㿐#c @Ru  |"䀤 @   @]@UW#v@US#v!#bP@ti, @|2 @t`b0b\@`4b\ 0`@ 㿈#c@̐ N,  2`@R0 "7!T` 2  @  ! @> !v"\`0 #\@ ?#v#a@t" @|j@ta @|b@ta a#b#vH@t @|Nb0!#v#a@s @|?b@sb\@`4"\ 0`@ 㿐瀦`"#0#8 @sð 㿐! # #Ԑ ? vxv  "\ X  P 0`? v@b㿐! #ؠ #Ԑ ? vU? v"\`,   0?<`@V0v@b㿐! #u #Ԑ    v}vb ׷ v@b㿐! #W #Ԑ  լ  v_ ל v@yb㿐! #< )#Ԑ  Ց #vDBBbp Gv bp uD!Ѐv!Д kg v@Db㿐! # #Ԑ  \  v  H v@%b㿐! # #Ԑ  =  vL v@ b㿐׈? "?㿐 -  "a` @+' #@   !5 `!h@rp@r `@‡ 0v@b㿐`   v@" @rax㿐@㿐@㿐@r㿐@o  @K㿐@-㿐@㿐  @ߖ 㿐 @㿐 @m㿐#{ 2ac@ F!{$#|@$c@>"#|@:v@8b@ Zc$c㿐@㿐@oP  @JȐ㿐@o  @J㿐@pz @J㿐``?  @͐㿐@#@q`0"d @ǐ@Ēa0ǐ@b80b @ǐ@b|0 ǐ@b0ǐ@aԁ㿐@c@c@V㿐!`@2#  "@2@q! #@bb v@%@b " @V0  , @b㿐s㿐#  "aX @)  @D!#@L@q 0v@b@qW!㿐@L#@q^`㿈#@Gc@@p  v@ܔ  c@q1#@v@kb㿐! #. #Ԑ  Ӄ  vy @L@q&`0v@Mb㿐  @{㿐 @_ @l v@8b㿐v"\c 0@  |@   |@  b\@`4㿐| "@M" 㿐.`|6`b䀦@  .` 2  ``& @A(㿐@f㿐@i@e ?bX`B'{@/#"@ ? "в @ @.@&,@/@l   ? ,",?@l`u"c @   l@  l@0?l 2l {@xb$ll`?u"㤐 !@ǒ   `@ l@u@!0 l@@u@o!㿐@@@^@${bH   "@ƒc4  . @  @.  {@.E""80JN $2N  0 94 N* ?@`" ?@@x?,  N @@o @nb耦 bH. @  @g$. bH @m/$bH+@mbH? $bH{""8@Q㿐  {cПat "!{#П#$at#П"㿈`#@@}+{c@Լ{cП`!#bX@@r0v@b㿈@j@}@  bh@#v@b㿐|"` , 2 @  "?@Լ? , 㿐|  b  ),`2 @ 2 b,` @ @ @ސ"@Գ@ `@,`@ː 2 @ː"㿐|  b @' )|'|,`2 @ "`@ b,` @  @S!x@A D @P@P`@,`㿈 , & -|+{  @@Tx " @ 2 `@|d  c@@Gt@@Q㿐!#{!l"!p$b< @c!l b< @Q"㿈!l  u@!   㿐  ϐ *`: ?Ѐ4@o $ 2 㿐!|. "6  @OU`" @"㿐. %|6    .   @O=` "`0 ,  @O1` @"㿐|  b % -+",` @` 2 @` @א@" H  @@ b@ʒ`@"@"   *`  (  *` 㿐{b<b p@m#b<㿐v 7#@1vv#,㈠  #@ # )/-+`  : c "@@㠠c@@  : ` c @xc@u @ 2` ͕,@j#㻨 o @c   # @c  #@M0V')@H# @`7   "3 @v - @4 L`# %#* :  | $@' cc? $c @ZL  *@`" L  @   @ #@H`( `0@ @< 2㿐 h `g  Z@ 8 @&c    @c   @c   @c0    +c`@#@@ "   0#"   `P#p#x@  X@! P@tD@@@ `@#0 @ h0` p@ 㿐'H  @?`  #@5c`?v#`Ѣ#+)9;57/뀤`"â` ` "` @@ 2 `H "` `@ "` ``@ @{! 2@@   @|` x`@sc   `@lc  `@ec  `@]c0    +c`@#@@: ".  C7? `acp#x$ `a(cp#xa8cp#x` !H`a`p@`.`@ss@`@Đ$@!@ؐ ` `@!`@! @`@@` @ ;`?X@Ւc v (?@7v# # " @;  "   X  @c    @c   @c   @c0    +c`@E#@@p "#   # @xcp   "@ @mcx   "@ "@ N@"@!bc`@#@@? X@Oc !! (?@7v# # " @   "   㿈@@@# % @  @, @ $@@1x  ' =@a$xx'  3ua@a쀢   ` x@~x@ @@@a0 u`@9 "耤` @Yx@L@R   *`  (  *` 㿈!x  u@ !   㿐 "5 @ N  J@?`J@ ?\ @"@  N *`: ?2,@   N ,@@㿐!ax"!|$! @Jb!㿐@!@Ԑ  aآ"@jC!|@ʐ 3!|@ !|@ސ!@ ? 2.a@j,!|@㿐 8 'H o\ 2i 8`? 2 4^-|,H`@z @{ ` + ` 2 ` @&@+  89+ |2 䀢 * 0   ` @  4` *`@&* &  @͒@ *@@Ē`@,㿈)|@Ey;984(  @$ (0\"``" "  0@z  7@zw  7 7@4a@_!|"+   `"``  @w" @w"@Eh "䀢@ @E^   @E@FĐ@9@$ "$ (@$ `$ (@8$($8@H|$4㿐'D `q`/91ۺc/-`` `@@"H@H?&H  ` @2  @2   2@$` 24$@0<` @  !$)`  @7@D"@W`$`@P``2` $`2`D" &`㿈. ($. @y2 |, " 2@y2 |, "2`@v, . `4 7@y}* 2 @8@y!Βb@5!@`, `@8ғ2``@8㿐|.`"6`@ .2 @@8f , 2 * 2  " ,` (@D`@D& (,`2 * 6   @D ,`/##@ @DB6@4@ &@` `2@ &@7 㿐` \@Dz @ * $&`@ * @$`2@Da @ * &@&@ * @&@ A  /` ,`2`t2 ( ,</#ֺ#c   "& ,&  @@b< D?& D  "`2" ,"D,&  ,&,D D H&D H &H& ,& D& H& (@E @E @@Lh` 7ր?`lp|^z'ܒ@C @ * $&`@ * @$ 2@CԐ  * $& * @$ dh#\0@̒b0 @C@L  b8@g?#@B   - #\#`t3` - #\#`t3`@@?ː@?ɐ@w @?° 0Y܀  e @֕-*   2`2(,</%֢#c   "&,'  @]<D?&D  "`2 ", "D,' ,&,DD H&DH &H&,&D&H&(@D@D@?i  'H"@'L77'77@!7'@!"X@!"h`@B @ * #@&@ * @#@Ԑ@!9 '̒'@!40d2  @!ސЀ <  'А $@!ϐ E*+ 2 '3 @!\`@wK*`* @wU** 2 `?    ' 7'\@w-* @w9* 2 `?  7 "-`@ А<2` @  ȑ* @$'Ȑ@fbÐ@!b(@fb @@NM   7F'̀ @BQ /@ @  <#$`@ @  # @A  @B2 / @  <#$  @  # @2JH@C7@6L @!@ XԠ fސl+ 2`"#\ƚ\d#`h#d`#ht#lx#p|#t#|#x# lbd@ey@eubp`  @ ̐A = 95`0\ d#dh#hl#lp#pt#tx#x|#|`##\#`#HL#̀ #\ К\'̀ @ 2<   $@ Ԡ 24"@ b@!@!@!㿐  @4Ǣ " @? .`.2`2  .@u@* 2 2   @u@* 2 " & #* 2 @ .`.2`2  .@u@* 2 2   @u@* 2 " &  ` x@tc@tc@tc @Bހ % @B܀  @Bڀ  '# @'耦`2'@hC '''    @~s 㿐@u , < " 2`   @ * @"2 2  , < " 2`  @ "2 2 8#hcp P''Ԑ@b'̸@tB@t?$쀢 2`o쀢 &#c@@d@鳒 0#c@@d@颒 @W @y   @y@3@3 *72 @7 @@'؀؀ #@c˒cx0uH@?x @/*c* `(*@ ` `* %@ (    (`(#  (#\#`#d#h#l#p#t#x###|#@3O@ @ @Di@Dgܒ @@@<&2@ @Р#c@cm̀@ce`  "0 @cY@p#hcp@sX@sU֖:Ԁ 3 ֖.Ԁ '#c@@c/@ɒ @~0#c@@c@趒 @k0@ (@  X `''쀦` @U'ؒ @f'@L''ܐ@G '$ݒb@!@``@bސ#    @|Ě ``"   @  @  $b@u!@@b` m@ ''@ '  @oi'ؒ   '@ 'ܒ  @``' '''ܔ%b@=!@h@b`А  @|g 㿐-*  `!&%`  @@>"`$`۔``2`@*@&㿐  @jc@ P @|@H x , )@  N# @)#V%O  ;֖ _ 1L  2 , ` , L   `@#V%;쀦 ǐ@Ւa@U@Ԑ@}`Ԣ @a@aa@?@?@18 @)' ,` 2`!@aϔ,` @j2 (@aǐ@aĒa` @& @B@B ,`%`"y` )|-|'|97"!0` * @a@ @a`V` @ "䀢@ 0怢@2  ?@v "@ y "@oB@=+|* "2  @b "䀢@ 0怢@2  ?@V@ Y@O "@L : @=* "2  @A "b䀢@ 0怢@2  ?@5 "@ 8 "@.@aAa"` `2` ,`%!@ !P@a,`@a)a` `2@㿐{  bP "P,``@T `"P @@"P9@<@@ @$TN n  N e N t N _ N ֔ 1*`:  ` N   "P@4T"P@B㿐 ,#|  2 2 , @=$  ,.``2` `26 @= &`6 @>&@0  `  *@$*@ * &b䀦2 * $* + * &@<@<㿐 !{@A#{{$"P"bhb@8" { "bLb#a@`fb` @`^bP@`YbP @ ?/#c;#bP.   @ @?@ T@0  @bP @ @ @$bP@9gP㿐 @#+)#' ,``D a`@`@`! ``@` `@& 㿐 ,``2` `2& (@?@h  >!|"|"<@jfT <!X@?c,#$ R, ?$@ (*`$T@R  0 , R @ ? 8R ?#*`R  `(`!@Y'`(  t 7?%t@2?T@,#?R   0@.  R `퀤@ 8R   X߀ 3 `T$ @j@h   @a@_ 00///...0.D.X.l......̝㿐 T  t`@e! ۬@?  "b` ȸ   "@^.` @ ? L5% : c@  @v"Ȁ  @@  c@ 4 .` * * ?`#.``   *`  ?`#`   *` @@?  },? JR < ␀?@%␀`an %!J   #$,  R @ "R ? !>␀ ?%۰ b&n!R ,  R   "* ?`Е*`  @!! {cԟ`{"Ā " X b@ڐ|!@a@=!! "$!@1m$! @V"a@"!!}@  @-"!x s"!{c` ?@? g?@b?@s]?@&gX?@&zS?V?@&K?@F? ? @&=?@8? ? @/?@*??@+!{c`@ ?@)j????@J  {c`?@В @???@'_?@@ @3@? ?@J ?@+֢@J?@J Т? ?@I? @I?@I @%R@$@% @I?@?@I?@??@I?@I?@IL?@I<?@Ib?@IR??@I???@I?z@v@%r r@n@I j@&'f@&O b@&{^@& Z?@I? @M Q?@I? @M H?@Iv?@[+ @?@In? @Zǔ 7?:?7@Ia?3@32?@I@3-@ @3'@I@@3!@I@R@Hl @I=  @I9?@Ӡ@@I0 @HV?@e  ""V?@& | "@3T@g  #(TR@g' #h@?ʢcR|"|"|"@Z@V? #@ec? "@C?@@e?`2@?   ?`2@ ? @ {c؟ @Z`?{ @u@'q@'m?@'?g?@'b?@'?\@'X?@2[@'P? ?   @'yB?@9 =? ?   @'O/-+ ) ' %?# !   ?                ,#(& R, ?% R*`&UR   , R @ ?"R ?#*`{R  `@`#@'`@  ␀ 7?%␀2??U,J?R  #,  R `퀥"R   ߀!۰ b?&  @d@b   @[@Y 4D445505H5X7??555555?56 6606D6P6h6|66?66767????????777D7T7l7>h777777778848D8T8d8t88888889 9$9<9L9\9l9|9999999:: :$:,:H:T:`:p::?:;;;D>h;p;;;<<<<(<(<8=P=`=?=p=?==============>>?>0><>D>P>h>h>h?>p>x>>>>>>>??>>>>>>>>?>???????㿐{"  `"  #Вcآ @c0 #В`#@x @A1{#؟{ "cܟ  !#آc (@`@  㿈{{"Ĥ  b'' "b@@       `" 5`@(aX "@^`` `h@T# {cğ@`@?쀤 $a`@T|#{cğ@@0&#@Tka @@7}"@"@@㿐@ӒaX "@ `` `h@TF#0 {cğ@h` "c8@T+#{cğ@P@/#@Tc @@7,"@"@@ːp'{){' !{#{%{"̬ %` $@5b%""԰? $"Ԑ@>$bܪ؟" @5լ@4 b ؟` `@Sʐ#@6ߐ ` $b"ԐД@N$"$@Y{""$%"́㽘!@d `.`Ґ# @@ "b`@S#{cğ@@/= #@Sb @@6"@sp @aX "@$`` `h@Sa#K {cğ@`@|"@E@A@aX "@`` `h@S3# {cğ@U`@:"@@ڐ `(@S#{cğ@6 @.ItJJ JKp{{"Ȕ  ̬  ''1{'''''"@ #"Ƞ@O @Q #؟@"1 "  #؟` @#%bȐ@1%@4 ( 5@>$@" @@ 8  @a    #@Ra) `$@?@,@U  #b(@R   b@   bȔ@~    #b@Rm 0^@`@ @g"/-;9@]@Ԑ@V@C / `@; 2`@R8# `$@?@;,@ (@R%  b@!  "Ȕ@  &@@0#0㿐@* @@Z㿐9 !@d $! 2$!@\ @{㿐$ #@O $a @G @f$a@ @< 㿐!@#Ȑ @ h㿐#㿐 ` ,  @' 2 6?  #c@@Q 0.@3   ,, @ & @#0  @n & @#@@    "@{#   @㿐@  2 @j#( @2Ȱ$$ 㿐`@4m @@4F @ .`  @۲`@.`@ @Ԑ㿐@  . `@ 2 6?㿐  ,  @ 2 6? 6  @3 , @    * @" @*` & @#Ȱ 㿐  ,  @h 2 6? ,  @:@  㿐  ,  @K 2 6? ,  ` 㿐{b !+{{"b✀ {   {""b b#"bb @ @%b@ *3{){%-#{&bb "{В"@"&b"{ .b`✠#ظ`7p5 /, * \W@ ` &&R   * P@ "(\ cp, P@!A+  , P@ *`S  , R  * W, R %R˰ , R b!, R b$&$$c-.%"yݑ*X@€ .acȀ  В bJ `?" .b$ $c%"$-.%"Z!cȀ  В bJ `?" .b$ $c%"$-.%"B!cȀ  bВ J `?"!J@ ! @bb{bȀ  cАJ?`;! @* @  * * * * .b$ $c%"$-.%" { cȀ  В bJ `?"{{bȐ `"{ "{5""{"b !@i !@ {cȀ  В bJ `?"{{ bԐ `"{"b{"b !@C !cȀ  В bJ `?" .b$ $c%"$-.%"@) !` {" {"✐ { {!" { {" {`#"T""#@cH~!cȀ  В bJ `?"{"̀`{ {"Ԁ "{"b {@  { *"bؐ {& cȀ  В bJ `?"{{bȐ `"{ "{ ""{"b 5!@  1!@ ѐ D{ .b$ %"& $$c -,cȀ  %"В bJ `?"!bcȀ  В bJ `?"!ccȀ  В bJ `?"!]cȀ  В bJ `?"!^cȀ  В bJ `?"߰!_cȀ  В bJ `?"Ұ!`cȀ  В bJ `?"Ű!AcȀ  В bJ `?"!BcȀ  В bJ `?"!CcȀ  В bJ `?"!FcȀ  В bJ `?"!GcȀ  В bJ `?"!HcȀ  В bJ `?"w!IcȀ  В bJ `?"j!JcȀ  В bJ `?"]!RcȀ  В bJ `?"P!ScȀ  В bJ `?"C!KcȀ  В bJ `?"6!LcȀ  В bJ `?")!TcȀ  В bJ `?"!UcȀ  В bJ `?"!NcȀ  В bJ `?"!OcȀ  В bJ `?"!VcȀ  В bJ `?"!WcȀ  В bJ `?"۰!PcȀ  В bJ `?"ΰ!QcȀ  В bJ `?"!XcȀ  В bJ `?"!YcȀ  В bJ `?"!McȀ  В bJ `?"!ZcȀ  В bJ `?"![cȀ  В bJ `?"!\cȀ  В bJ `?"s!acȀ  В bJ `?"f!@cȀ  В bJ `?"Y!ecȀ  В bJ `?"L!fcȀ  В bJ `?"?!gcȀ  В bJ `?"2!hcȀ  В bJ `?"%!dcȀ  В bJ `?"!icȀ  В bJ `?" @ !0cȀ  В bJ `?"!cȀ  В bJ `?" @ t!0cȀ  В bJ `?"!cȀ  В bJ `?"Ӱ!*cȀ  В bJ `?"ư!+cȀ  В bJ `?"!7cȀ  В bJ `?"!cȀ  В bJ `?"!cȀ  В bJ `?"!4cȀ  В bJ `?"!5cȀ  В bJ `?"x!0cȀ  В bJ `?"k!jcȀ  В bJ `?"^!kcȀ  В bJ `?"Q!lcȀ  В bJ `?"D!mcȀ  В bJ `?"7!'cȀ  В bJ `?"*!(cȀ  В bJ `?"!!cȀ  В bJ `?"!"cȀ  В bJ `?"!1cȀ  В bJ `?"!2cȀ  В bJ `?"!3cȀ  В bJ `?"ܰ!cȀ  В bJ `?"ϰ!6cȀ  В bJ `?"°!cȀ  В bJ `?"!cȀ  В bJ `?"! cȀ  В bJ `?"!EcȀ  В bJ `?"!DcȀ  В bJ `?"!:cȀ  В bJ `?"t!<cȀ  В bJ `?"g!;cȀ  В bJ `?"Z!.cȀ  В bJ `?"M!-cȀ  В bJ `?"@!/cȀ  В bJ `?"3!,cȀ  В bJ `?"&!)cȀ  В bJ `?"!=cȀ  В bJ `?" !>cȀ  В bJ `?"!?cȀ  В bJ `?"!8cȀ  В bJ `?"!cȀ  В bJ `?"ذ!9cȀ {В bJ `?" .b?$ %"& $$c-. .b$ %"& $$c -,cȀ  %"В bJ `?"!&cȀ  В bJ `?"!$ .b$ %"& $$c -,cȀ  %"В bJ `?"}!%cȀ  В bJ `?"p!#cȀ  В bJ `?" @7!  {]"cȀ  В bJ `?" @$!  {J"cȀ  В bJ `?"В @! 09cȀ  В bJ `?"@! 0*cȀ  В bJ `?"В @!0cȀ  В bJ `?"@ ! 0 cȀ  В bJ `?"J{-"+֐ 1  ``  #@ch{#@c{cȀ  В bJ `?" .b$ $c%"$-.%"ϰ!cȀ  В bJ `?" .b$ $c%"$-.%"!cȀ  В bJ `?"{ "`"cȀ  В bJ `?" { !"bcȀ  В bJ `?" {@> {cȀ  В bJ `?"@` {p  &.?b $  / { %b# $#b ᴔ " А@%"@bE@"  p%"@ " !  !{R&b'{N&b@$!  {bb?Е2 @  %":  y! 9{{@.b4{А@w%"b@="b ᴒ@ @k%"b@r"@ {WtmWWXPmY<YZl[`[\] ]@]t]]^^D^x^^__H_|__``L```aaPaaab bTbbbc$cXcdccd(d\ddde4eheef f@ftffggDgxgxggghhHh|hhiiLiijijjPjPjjjk kTkkkl$lXlllm(m\mmmn,n`nnnodoop0ppppq(qrr|rs sPss[Zrtrssssssrsss㿐{{"  ` " @O P ` {Д"⬔"   А" ?` .  `$ 2` %!|"`"? )+  "  *` 4& 2`@&  `@ & &   @ `  "@ $4` 4  *'{@? "@@ `  "`  `* ⠀ `* 2%!{" ` @ǐ %!`!{ @Y"  %!" ` @ !"`!  {"@  { @b!" $! %!* `! * `%Ё㿐{5{37{{cЈ✀ H13\ آcp!I ( .T$!#a`R@ (T"(\`#p.RA..`Q(V@R@ ( T@㿐 .`1{P" pW@(V (\.`QaA/ .` W@(S#pV(PaA 㿐{{b   ,b` ##`  `     *b`8␖" ` `   @ "`@Ȑ ؠ?,$c ,$━㿐{%{ ᰦ b*bJ 2 ` #(*cа"B$"   " "{@b@i ?!`{{@b{cА$"" * " `?$" ,# 㿐` @J 1 J + @S ( 2@]!({ & @& & & & && & & & $` { a*a" " @ "!㿐 !{ {{.@o   " "   "* "`*  {{ {b "    *b""   !!# c @(ᰁ 㿐@e!& {{ (& & "@"⠴ 2 @  @& &@ڐ  @a&{"  { a*ab" " @&b"!b & & & 㿐{b `  $   $b@@b  { a*ab" " @$b "a{"Ā " $" "$"@$"ā㿐 { R"" {0 ^{0~cП`#@a!@Ӓ  @?  @Ɛ @@`,{bԖ ?D#bԠ{ 5"b!2Ea#@i @=09@a  {bԖ ?##b*@ 0%{ bԐ?"b&`&` &`"  N 2 @ɐ{b &@ &`&`@ 㿐{{"bП ` {"` `@O" {{"` ` " ` {@Cb{@Pb  0!1{""!{@0" "@$""@6 @!{{$bc̟ @ $"ԁ㿐{'{b * ⠐ (@! 2 @  @y$` $`@  @ $`%"@$`  $@@   $`$`"{ ` #a$#" @({ "b㿐{){b  " (@># 2`@H `@5$ $ @?  @$ $@Ր $  $ @j   $ $ `` " `" !{ {   %"#"$# @+ ✁㿐{${"Ā "! ` ""*@*` """${{""b" +!#@Cbp㿐!{" {@6$""@^@㿐{  { a*a" " @  "a㿐{;7{5{9'a&&#/!㿐@ ( 2`@ `@& & @  @& 㿐 {b""b  @u @s㿐@ &` & @`   & &  { "((""""${{"! "b## @*㿐  `N 2`@㿐`@!  @+!X @@ , `@& *, 2 @! &`㿐@S㿐@㿐@Q㿐a@9#@% 㿐 {"J`;@ ;0@ 㿐{"b {{"Ԁ` !{ !$"  $"{ "b!!㿐{"b {{"Ԁ`!{ $" $"{"Ѐ` { "b!㿐#{"b!{@" b$""!{{{""c̟ @ $"ԁ㿐{b܀   #{b"2${"Ԁ`@Ӑ!!{" b$""$܁㿐  @? %LV?:L㿐{  b& & & @"b@  N@ 2 {b & & &  㿐{aԀ  "{"Ȁ`2{ @wc{ "b㿐{{ Ԁ` "{"b @ {㿐9;#7{a.#Є@&@/a.@#ȁ{  { " { { 㿐{bԀ @/c㿐 { 9{3{;{ "!&b'""c/a#✁㿐{b耢 '  {"` "{" {{{b""Ā""# #  b$""`"` "`{` {`"`  { 2㿐{b . : gЁ㿐{"Ԁ` {"b  㿐{bԀ {"Ȁ` !@c0@c㿐b(@l#@X? { 㿐{b4  a"4  "@箒ca  1{@N �@ǐ"#0$4$aa$a㿈@Oƒ?# | #8c`@熰 01* @  *@M'{#{@ @ |!x@ "@& T@%y c$@c$ @! dc$ *  " $c$$  %@['|   @@Q %  #p'@@cx@E@Oe?#@PU* ` `  *`  ` ` * ` x#!|#%@ ''@ #'@ #'@А#@(c@"怢 %{c$@" #{c , @ @@怢 @V  @ @ Ր{$c { c${{,|# ` x@%,g"_ 5;9|"*`   M/"T @ "(  :|26|*"    @- ""@&@쁐?,` * @pΐ ,`@ ,`#b@*0@ "@浐 %|$"47c %| 2{$ /;=c ?  z%{ $`'{!| , @ !x@%* @湐 @ {c$ ` `{$ {# ``{!# b@@b@L @@@0  $9{<&`T{,V`  @ U 6`(@ `&` H`H `D&`HD  &`D`,   2 ,&`,$ , { 2 {c${{ $U+{5#1/c ,|  x@$ @MӐ|*`  " T #%T耢 @Z H '@o N @Z @o 8@?, ` @o, ,  L @oo{@q@o@`c  "@{c$c 耢#@b@@@@* * * *@ @&@@ @@p @@ P@8`@&`@` # @`@Œ`X@`@n۔ b@b N`? $`@& #,` * $`#, `8  ` 2`#,&`8"`@<㿀{{#|{{  "`p  #"#c@| @ {{"b# `[  @ '{){/+{/@M` ,    2?`@ @$ @XF {"b@@N|{ """ <@ d"""` d@!%#%  @#%cA c (`{ "c("  @䢐 㿈{ #$@ !){'|%|# ,` @ x@#^ ` @L` * "`@!`c$@# {# `@#@䏐@㿐`p  "`p@nb! P @n{"`2{@(?,   @nw, , @nK# ! D #@m@H{ #@  {{ #*``@ "{"#o ({"c{ T{"c/" #b@ "@b@? ,` * @n3 ,`@h ,`b@t*0@pb@ 㿀{"`2{@nc! N #@m@ <`@{{{#'{/{#@r  @i 0  `T!۔ `8)|$`8$`T''''@˾"" @˺`@"怢 "`@ ]"@ @ T` @m $ " T" 8%㿐{  !#"b8@@b؁㿈{6 c# Z@:: " Z 2{${@no @ms# ! N #@m@p{   @S #a#{@ΐb쀢`G@ǒa A$b?## aa"  %# @  @@K<?c  !P@aἔἀ 2?2{2{{{Ἒ? #@p㿈   +)&'“,? #@ |"!,`? #2`|"䀢  , 2   @I,  2@ a,? #2הa!,`@ 2Дaἑ, 2@㿈{6 c# Z@:: " Z 2{${@m @l# ! N #@lW@{!    @R  !#a1{@ "쀢`2 @a &" ??!c  ! 4@  4  b   @R   a#a1{@ِ"쀢`2 @ђa &" ?!c?  ! 2@ 2  R?ۖ#` #  %  @ ~ @?aa#@ ⸲@ n @ @J?c a !P@ޒaaa 22{{2{a{? #@ox| @Ȥ @I{6 # Z@:c: " Z 3ۀ$@lʐ @kΐ# ! N #@ko@ː 3ې@nb@ h` @ ސޔ  @F}#{c ( '' ''@ɢbb@ɞ  @|怢  @ A @s   @ 8  @k $c$c $㿐!{a   @" $#0@m"#0{$a"c4㿐!{@#0{"$#0"c4"㿐@Րm @ג㿀@ //@JM @怤 $/㿐#| `@`, `@7 {"b{ 㿐 H @V-㿐`< }!{#{%#@'{c @$#{$c "#$@@${$"#(㿐 %@~ %@  㿐@l?N "N ".  㿐!{" {@{ `# <""@$"{@c|㿈@C @IÒb@5}{ #`#`<##"@^P㿐{ #,  @   2 @ 2$@#($`$ $,$ $`㿐@j@j# ! H #@jN@۪@?  "bȨ` ȸ   "\^.` ? L4$ : c@  @#@  @ؐ@֐}  c@ 4 .` * * ?`#.``   *`  ?`#`   *` ?@  @,`?!vR < Ȁ?@%Ȁ`a %"J  ) >$, "R @ "@R ?ˠ ǀ LȀ ?%۰ b&n R ,  VR   "* ?`)*`  @gxutp@ l?怢`d" x?@ `\mX.TP??K?#XE? ?? cX?cX?#X?3?#X,?}?'$?!#X#S`@HT`@ }?- & R- ?$ *`&TR  `> ,`"R @ ?"@R ?!F*`R  c\`#`@r'c\  Ȁ 7?%Ȁ2?T,`v?R   >􀤀, "R `퀤"@R    ߀ L۰ b|&  @e@c   @\@Z 4DTdt,<<Xt  㿐"Ā #X#" P#p@D"@]㿐@V "cP㿐{ct !{{cx "t "cx{| {""|c !{#"c#l |@$#l@k){'#p !Ȫ,{#x !|  D#b- % . * V@ ` %"R   * V@  ̂|"DⰑ. T@ +  . S@ *`T  . R  * U. R 'aѠ. cR $!. R $$# *a,%#p*H@€ !,a! {! "cx!  {!"x {!##xcP |"cP!!۔ "bİ! {"#x۰! ""۰! ""Đ {!"cx {!"x~!۰! y""{c @ M { k"ct#{ Ȑ$,?cl $  % { $c|# $#cl ̔ #p 㼐@%#p@k #p  %%#pd#p@X " 1  #p##p@-&!Ѐ  {#x?%#p2  : \ !Ѐ {@4c|㼐@%#p#pcl ̒@ @%#p#p+@!Hhp  4HPd㿐{{#l ̨ ` #p @ɐ!l ` #p㼐"   㼐" ?` .  l`$ 2` $c"`"?`(+{-l#p  "  *` 4& 2`@&  `@ & &   l@l  "@`%#p@4l "c|@? "@@ `  "`8 l`@ $*@c|  lc|$ `  @Q"@l`@$l"`̀   ` { @`c|l" $l $* l`̐ * l`%㼁㿐{1{pH#x1 3|"Db!I ( .T$!#aĴ`R@ (T ̞|bD".R..`Q(V@R@ ( T@㿐 .`1{P#p  DW@(V ̂|.`Q`/ .` W@(S"V(P` 㿐{{cp  Ȇ ,cl` ##` ̄ `     *cl`8l" ` `   ̲@ "`@h"`?,$c ,$p㿐{ Ƞ cp*cpK 3 {l`̐ #(+ c#h$#p   #p #p{@Xc|@< ?!Ѐ`{{@Kc|{c$#p#p *#p$#p ,ȁ㿐` @J 1 J + @ ( 2@"{l & @& & & & && & & & $` { ap*pal" " @0 l"!Ё㿐!{#l {@6|$#l#l@^@㿐{l  { ap*pal" " @ l "aЁ㿐{;l7{5{9'a&|&p#/!ȁ㿐@ ( 2`@"`@& & @" @& 㿐 {cl""cl  @u @s㿐@ &` & @!`   & &  { "((#l"""${{"! |"cp## @*ȁ㿐  `N 2`@㿐`@!  @+" @@ , `@& *, 2 @# &`㿐@͐㿐@'㿐@ː㿐c0@#@   {{ x"#t㿐@*?㿐T` "|!@`|!#`8@3@3 c@3 `p@3c@3`@ @|@.b  @O T` @t㿐. 6 @ :|,  @ R  |!@`,`!#`8@2ϐ@2˒c@2ǒ`p@2Òc@2`@o,`|2 b怤@d @.v@d@0㿈  @o!|" ` 2$` @"`@"@̒#\   @;ƚ #\   @`6""@ @Z㿐@`  @d/ /@`耢  @d, #@Ւ` @6 @ʒ`  !#a@2F@2Ba0 @5 㿐. 6 @  @- @b 㿀  ''@bu '  @bp'  @>ݐ @b 㿀  ''@b] '  @bX'  @>Ő @bm 㿀 '' ' @T'㿐  @c: 㿈  @#|b  2$ @/2 @) @%b`@"b@#\   @: #\  @_kbb@K @㿐@aA@`@D 㿐@a7@`@; 㿐. @-]2 @a+@`@. 㿐. @-P2 @a@`@" 㿐 @4c x ؒ '@'   @2є  @a   @a @aє 'ؒ  @aW'@'  @>  @M x. @#E2 ؒ  ''@   @2  @a   @a @a 'ؒ  @a''@'  @=  @M xؐ  ''@ag  @a '@g'' @   @2i  @aT   @=  @M x. @"2 ؒ  ' '@a; @aU '@;'' @}   @2=  @a(   @=  @Mj 㿐@.`6`@o !#c8@0|.``  @ @0cP    ,`2  @S @'@~㿈.`6`@C !#c8@0|.``  @ @0cP    ,`2 #\  @^) 㿐.`6`@ !#c8@0b|.``  @ @0VcP   ,`|2 䀦@  .` 2 @㿐  @㿐@  .@, @ , ` " 㿐   , `2 ,    @j , @ `,@P , "  &㿐    , `2 ,    @:  , @ `,@  ,`"  &    @`@0 㿐 @ @   .``2`@.`   @ @ .`@ ,@ , " `@& `  @`@i0 㿐 @ @   .``2`@.`   @ @ .`@ ,@ , " `@&      @I&@)0   6  (P   ( 㿐@}  " "`㿐@ 㿐@Ŕ㿐@Β㿐@ P 㿐@㿐@㿐@ 9 㿐@r 㿐@ xؐ  ''@_!  @_; '@!''  @;xؐ  ''@_   @_$ 'ؒ  @^'@'  @;l㿐`@`, `7`(` / 5|/|-+) ꀢ@   @ @h @b`H@"`H?&`H$$` 2 ` `2`$|b!|@E"&`(@`"@ `@ ** *@ * ( + +@ @&@0㿐`@ , --| % +)'%ꀢ@ &@ @ލ H@މ H`?$ H$`& `2 2 @ @ ?  ** *@ * ( + +@ @K$㿐 ! aV  !#aH@-ؐ@-Ӓah  2 ᠀`!V` !#aH@-@-ah  2 ᠀!V !#aH@-@-ah  2 `ت '  '@])|@'@"@ o  | 4Ȕ$ $ '7@&"@] 'ܦ'  @:1   @J@\'@"@ G  | 4Ȕ$ $ '7@"'  '@:    @Iߐ@\֤@\E @\в@\> '  'ؐ'@9' @] xؒ ''`(@ @² (@\@\m  @]} '@d@\''  @9Ȑ @]p (@  @ @`@\@[ @\'ؒ  '@]S'  @9 @]K ` @[ ` @\`㿐ؔ #@,a @^@\@Z@\F\  `@`@ @ `@d`@^@X'#P"ؔ@Ő@@=Ő@[!b@2 㿀V  !V` #b@,B@,>bH@@@ ''@@ @M @̐"@[@Đ0@J  (  +@ @\a" @3 @b' ' @8Ɛ @, '  '@8㿐` @/G @  , -/;-#c""   " '%#$ @ @B H@>b H?& H 2  & 2`2 @/    @L&㿈|.  "4 @9r`,`" 2` 2 22 2`%`@D`  .  2  @   2@ * 2`@  *`    2 ` "h@<b㿐@#{ ," /c# `"` 2`   `"  ` 2`  " 22 "b@zߐ"@{ *  * @$c@ 㿐@n#{ , c* 2   3` 2 22 "ْb@z"@z*@*  $ (@{$c@s p!{# # @:ؒb#|`. b@. 6 @``@6b@ 6 @@ 6#@  ؑ6 '@&p'M@V'@'@&d6@J'  @7V0!|֓6 @8""@86@&M֢@ܐ@ِ@0@&AԒ@Y@Y|㿀 '.'. 5  `4耤, ` 6  @ |6@Y  ?z `-`2`@& -@&2 @Y@  '2`@,  ''  @6 @* `'@%6-@%2 @Y@  A'@,6='䀧`'-`@%ʑ2 - @%ő2`@Ym@ɠ  '-2`@+ '  @6 @*f `'-`@%2 @%6@YL@  '@+đ6' @6 `'c'P@9'T@9Œc@9c  ` @@ ` #b@yW"@y @ @ 0Z6 *  ,  @  @@F!  "@  @Z| ֨Ԓ@Y , 4  @S,`4` @M!!#b@)Z @1#b@)Q @1@)J @1@)Bc  |@@X  @怢 " @@ @  @@ 耤@А'`,``@怢 "```@j`@@e`@@`Ң`@@&`P ( @2   @Đ ֚   2 $  #\@2$ Ԟ   2  Җ  0$ @2#\֖  2`@%$ @ P`2.,( Ғ@%, @Ñ4 @ޒ@*@$@*@ $, 4 @@̒@@@Z0!`+, @" ` (@4@@` `2@, 4 @@@9@!  '@XĔ  @/ @<"@@$0֒  쀦"`@$%֠r֒@W` @(Ւ @$֒@WW@ 쀧` @@$ @ @@ @#֔"`    @B ` 2'@*J֒ @X "@֐@5|"@5@#РΖ  @3@W@   "@4ǐ @( "@@*"֒ @Xh 1"`|"@5@5@#РΖ  @3@V@ "@@*֒ @XH   "@4 @(P "`@)֒ @X8 "@֒  @4`"@)  "@X"`@#u"@@)  "@X"@@#f"`  @4] @W  @X P 30`"@#MԔ @3W Ҕ @3S @#@Ҕ @3J Ԕ @3F @#4  "`    @AL TҒ  '  #@    @A3@ @ @ { @! @x @@:`-`{ @@  $|ؔ ", '4 '@"ې@'@d'@"ϐ@'  @3 @Hl `@"@  @W@  @W @  @Cz  @W+  @.^ @Vi@(@UՒ @'J @UВ@ Xؒ @ ''@'H@v:.@#Pc` "gZ @:: "  @v%@v?@@v * 3 * *bgZ @:$ :` "@*` * " 0 *@6~*`5@i2 `"@  @Wj  @V  @- @'ؔ('ܔ#H @*''  '  @@2 @ ,`  @ע`@,`@ N@uŐ㿐#{ @c ; @ |   b3@@c@@ `` #ch@& 0!#c@&c@%@%c0%ْb@u"@u㿐 : , @ 0| @怢 *|  "@ , @ "  @ &   , @ @Ɣ  & @0 & 㿐{#`@w !##c `@%@%cH`@ ې@U(ڰ  @ `2` ``   `+ ` 2  ` V   @@Y`@ @ k 4  < @@     `bg:Z @:`"@ , * "@ |{c c @56b` [*!, @`@(Ȓ XOR B J : B 2 : * 2      ?"    @( !##c `X@$Ő@$cH@TV@Ѱ@ϐ@>x(H`x㿐{#`@{#`"@ @]@@  @; @3`*`,` @@.`"   @`.`" `@ɐ . "@ ` @ . `"@ @Ҵ@&ʢ @@e㿐  @@s̑,  *% k* b _*-@ 2U  @ @    @ ">  @ @    @ &,  @@  `@K `"2  @@  `@:  `"2$@`*@s]x p' x'@s!@SI @s!@S; @s#@S-`Д@s!@S ՐҒ'Ҏ'!   @T  !@Tv Ѷ  !@Tk ѫh'd'! ! @TYљV(@sK'h#a8ax@Rδ ф@@s9%@RXv3'/'! !` @T$d!''  @TT' '  @TD%!h!x70h'x'! ! @Sސ㿀 `''쀦!`͢!'`Ȑ'   @S &` #`ѳa #`ѥa@E!!ِѕ!'ѐa'! ! @SŐт'}`'# a @Srв!m!BЧhА ' ' @@aUaP@Q@6D 75 -` `@@  @@5   @>Œ@QW*  @> @QL  @m@  #\ @+J 'ؒ  'А''@.'"@@&   @R@OaȔ; @R@  @)s aД. * 'a8'В'ݒaX'ؒ  @.!@$! @R  @)H a@@_P  !##c  b@!@!cH0   & :  5@,````"@ @ , . @@`@" @@`- ` "@   " `@``" `"` " `@`` " `" Ȩ b0`@qC @q>b8` @ "gZ @:: " @p@p?@p 6*`- * *gZ @:$ :` "@*` * " 0 *@1*`5@@2  "@``  @` "gZ @:: " @pf@p^А?@p^ * + * *bgZ @:$ :` "@*` * " 0 *@0*`6@2 `"@ 㿀 ? (@ 2 @L&&aϝ('@! ϓ &a&! φ& a&}y@Oߐ'!|`o'  @Qe"@E   @Z @W"  ` ,  , @2` `&@@   @<Ԕ '  '@Q5㿀  ' ' (@  @Ȑ )|'| @"'@'  @Q @ꀢ X `Р (@O|`'`@O @O='` (`@N@O,'@O_' @, .+ ,|"*`"  2` "22 2 4 @W@T @ @   '+ζ`@N@N' '@P aΧ"@   @ @`"  ` ,  , @ܓ2` `"@%㿈    @&1&Đ @"쀢 2&耢 2&  `@?    `"쀢 2&耢 2&`@ -`-{` @ "@ #bH@% 㿐   @'{    `"  `  @㌀ ! א ` "`   ` ې @㌀ "p   "#bH@ݰ xب `'쀦` `@Nc-75 '`#'’`@M'ܔ  @Oa͵@MŐͭa@M'@M'ܒ  @O@M@M@3 X`T-R @N  !' ͊'ؒ͆@M'ܒ̀'  @+6@M@M'r@M'ؒl@M''  @+ @M@M'\a'ܒ  '@+@M @! '   '''@O' 'ax> @Me!'7ah@M^ 'ܔ  @*,@MS'@Mg'ܔ  @O_@M,@M^@ '#'آ`'ܔ  @O''@M@MB'ܒ'  @*'  ''@O.'܁pغ'L'` 'P'T @@@aސ@,@ L " `` `@`     @!` @ @ @MC''ؖ    #\@&'ܒ  @*b @L''@~@M-''  @*U@L '@~P` 'T̈a'P `'T`u`'@8'ܒ  @*'@L'@~'ܔ  @*]a  @9   '    @&#\'@@~@L''  @)@LͰ'ؖ    #\@&j'@Ls'  @)@Ll'ܖ   'ؐ@Na'`"@@ @@IL @NR L  @ [ @@@x !{''@#@L@L7@#@@|@b@@`'@L ''@L'''  @) '@~'ؖ  'ܚ   @6 @N  @O@L X{#'@ U ˪a˥a@  $,``@`` @`@&` @B#\   @% '@}ѐ@}ΐ@%'    #\  @% 'Ȑ $@@В    @6F @@0x7|XaSaNa@K '@}@K'ؠ'ܔ  @( 7  #\ @%f   @8” @K'@}x'ܔ  @(ސ   #\ @%L   @8 @  @  " #@b @'@ 'ؖ    #\@%' @'@ '  @(@@hк'L' `'P'T@4@aҐ'^97`.   @}@` @}@!hʺ   @8Jxʱ  @8A ` @|@` @|@ '@|'@|@J'ԒTِ'@|ݐ@J'@|ؐ'  @(>"@@@@@@@&`L P@J aa^ @LU P  'Oa8''ԐIaX'ؒ  @' @|''В  '@'@J`'В  '@'@@́p 'bЪ !#bȐ8#\    @$G@ئ   @a` #\  @#M '  @&ΐ' aX' @I'ܒ  @KB@I@IA@ h'a!!8  @6  @^  a'@H'Вڐ@H@I'Ԕ  @K  'ʐ''ĒbРܒa` #\   @"''ȱaX'  @&g@H@H@< xؔ 'a'ț'a8Ȗ` '@W  @:'ܢ  @J@Ha~'aXy` '@:  @:ې'ܔ  @Je@H'ؐ a'_'ܒ  '@&@Hxؔ  '''Ha8!'ܠ!B@Hi#'a;'  @%  ''ؒ+@HR'ܒ%'  @%ېa@H%@HW@H@HO'ؒ  'ܔ '@J'ܒ  '@%@H''ؒ  '@%p 'a''a@H'aX'ܒa8'גa@G'Вa'  @% @I  @ C @  @:)'ܒ  @%r '@z'В  '@%g@G'В  '@%_Pж!'%"Ȫ@(b@Pΐ!!`ljŐ!!ǀƼ!!wƳ!!nƪ!!eơ@@Gi @ٔ bƕ`=!"ВaL%8#aXƄ!"=aДy6r/k!!&b!!YA "Вa%X#  @Ya8F!"aВ @K 92+#!a! ݐ  '%%'8ː'Xǐ'  @H@F@F@R ''('ؒƲ@w  S 'a'P'''    @1x ` @ܔ @   *2 ` '    b@f#0Z4 @f'@f'@ Ȗ "g:Z@: " . @*`"  *" @                ?  ؐT  ĐB @Ȱ  a@Ϡ  ꫐@ Ē Ē 'Ѐ` 'Ԑ ';'ؐ '    @0    !!# !#@Eؐ ''' '''' ''''''' '#c ch@@cH     @0x'Ԓ   'Ж '  @0l'؀`@, !@w@t`   |"怢  * @ " 2    @@Ӑ @3@e@é;P;;;; ;0;@;; ;0;@X & :  '@@e-`#c` "gZ @:: "  @e@e?@@e + 7 * *gZ @:$ :` "@*` * " 0 *@%*`6@ܑ2 "@  @Fݐ   @F%  @X @y[@, @m@,` @w`@"@ ?   @@y<&@, @N@,` @v`@"@    @& @v''ؒ  'ܐ '  @/p'䀤@ ,`  @`@,`@@e㿐> !##c `@c@^cH`@@D7"g:Z@: " * @*`" `` *`# @ Ɣ     c@*#@`@k@BC$BCC$C$C$C$BBBp@%`ؔ '@'耦@v] @ @vT ?@   `#`C# @0  @E6 @i 'ؒ m 'ܐ @E(  @[ '@v('    @.   @F @Yց㿐@  ``@ @k !`aT` !#aH@@ah  2 a  ! #`H@@`x #@|`@!@@D / SM  H@C| !@.`@C@@[㿐?@d "@" x{ؖ ##'쀢`' @$0b @ `2@  @i#`@f#'@#'ܒ  '@ Ȑ  *@ 㿐c@#@C㿐  23  *  &&'|%|#|@$ * 2    쀢 b*  `   "   "    *@& 㿐 @ ,`"H` "@`  @$ | |("2` +`"@   |"쀣@ "   (|2 怢 @Y 2 "  `     "    2 ` `2` *@$㿐@ǐ!@@?@ﰐ  % , } u7/7|#c @$. |("2` +`@   |"쀣@ "    (|2 怢  @ 2  "@ "< (/@Ͷ@vn  $ @  2 @ @vO$@@v"@ $@,4$ @΄%@8 2" 2 2 @ξ *@*  + * @^&㿐 @x @m@@ 6I'| ,`@ +  R 6 @# | ( 2` @ +`  |"쀣@ "   (|2 怢 @Z 2 "@#w* b2  2`@& @Ւ @ .2 @-  ,`7#@ `%@-|3| @#>| +` 2`+    |"쀣 "   `+`|2 怢 `@ 2 `#@##* b2  D@# @#, 4 @@k$4@a,`@]4`9` * R`-@"@",`4`` ,``,b2  @@=$4@3@0 ,4@)2`@%2{` `2o@. 2 @ @ʒ @@@@q&  @Q*  2 @x @ﴒ@ @U& @~ * *@ *  @2&㿐`@rِ   aP@~#05" ,"I 3#3'@ "#""  `a@a @ @`a   @@`@@y 2  |@@ 2* !|*@  "@~&&  @z"&  @@a @"&  @" ,8& +``@ `"``"& ` 2``" `  ``$ @J$ ` `@"@` 4` $` 2* *@ &@l 㿐@f`(`%/` !/ @ " `"& ` ``` 2`"`#`"&   2 `2`/@c  @&@@paԐ @`(` @ ` #@ "  @ &  "$ @Ӓ& & `2@@ #@@* @&@㿐` (@ @s`  &`   2 @* @s$@" @ɔ@*@$@㿐   %#! ` "@ & a` a!0@   2 㿐/V +! #a@.` @N2 @b. 4`@ *  @A2 @b@ *  @62 @b  / W  *!#a@א. @2 @Βb,4`@ *  @2 @b@ *  @2 @b    㿐|. b6  .  R q@ * @te2 @ * @t_2 @ * 4 @ * 2 r {cğ @0Q5`T T` b@@j#{cğ@@6 @0Ӗ 0@ [* @ 2 T R`  @0 " @ 5* @ 2 R` T`    @0@s㿐N 2# 1c')+J `!"`@^ϐ  h@c@0@ʐ@^Ð@`"@b@`J 2 @^{#  Փ*# " " b@#@㿐@^ !@˒aЁ㿐@j   @* 㿐. 6   @Y   @ 0@| 㿐@J  @  㿐. 6  " @9  @ 0@\㿐@*   @ 㿐. 6 ֐ " @   @٘ 0@< 㿐@  `? @ʘ 㿐. 6  " @ `? @ 0`@?㿐V  R` $b@@@#{cğ@e@  @/ 㿐.`6` @=20 @ 㿐. 6 u @=K@ l㿐. 6 g @=D@ 㿐. 6 @r͐ @ Đ㿐. 6 M @ 㿐.`6`A @=0 @& 㿐. 6 0 @<@㿐@]b`  bh@ #@@}@]v@` !#b@ @ b`㿐 @nՕ.`#"@ 㿐4 "4 # , @.`@nސ .`c " `㿐b@]. {@a @]'{  c@%@] !{{##  @]# #@\#( 㿐| *! @8 "`.@   *  @ : \2  " \ ( )2+ + `+  `*  @ 2 ?+  I@\``  "?? .@ `:.@    *`  : \2``"`\`(`)2.@ .@ .@ *`  *2`?.@     @?@\c ddcdddd㿐  (.` .@   *  @, @Y& ?@@\  ", .@ @ & @+ `: \2` " \ ( )2+@ +@ +@ + ` 2`?+@  &[@[ؐ@S " .@ .@> , @@  &+ `: \2` " \ ( )2+@ +@ +@ + ` 2`?+@   @[ ?@[ 0&a  ) .@ .@?ggexggefggg㿐 @[t @[n @[n*  N`**`  :  \ " "N*`*@`N  *` *@  2$  @[N  @[I 㿐 @ @[1 @[1*    `**`  :  \ " "N*`*@`N  *` *@  2$   @[ " @[  㿐N   ( N `?`?@Z N( N `?) N `?" `@Zנ   㿐N   ( N `?`?@Z N`( N `?`) N `?" "`@Z  㿐N`( N `? Q`"ǐ@Ԓ?@  2$ @Z @Z@Z$_ @Zu ) ϐ E, `" N`( N `? c  @ZX? @ZP  ۰/)͐@   2&   @Z>@Z<  @Z7  @ZC 0@Z. @Z,@Z*0 `  @ ?*`?? ?  * "   $ 㿐@ @H @ & @鯐@ `D @ @u@閤@7 ?#,`|怣 )|"䀣 % ?|*@" & @       *+@ 2+@ ?  @Y `@Б,`@㿐 A@ۑ@ @糐& @V@T$ , @ *@&7<#c     " " " 2!ǐ!@ *@*  + * @u&@㿈@   ,5|/+?7#c?|* @ R o  @? cb*  `4,`2 ,`cb*   `3 @ a@X @䀢 ?? @ڐ  $@]+)ccb*  `!@䀢 ?쀢? @岐  $@5c4 $ 2y"?8@ 8@ ?㿐@|@"T@a@jT㿐@!#T @$#T *` 㿐@Xb {@ @X{ c@ҫ@X {#㿐@_@ @恐& @$㿐@Q?@ @s$ @@ "  D H @  (" ( , 2   `*`( "㿐@  , * @" " 㿐 ,  "  ` D@#@Xc` ,   "   ` D@`? 2   `*`( "@     㿐. 2@6㿐`  2 ` &`"`    #@WcА H?&H@ ې@0@㿐`  2 `  &` "`  #@Wc`& &` "?    "+? *@ +    \8"\()2*@*@*@ +   *8 "*@*@ 㿐 8`' @@  &`  : + `  *+  ?+    @W#``ݠ 㿐@@k  IJ    (*   8\" "J * `J * 㿐K @W X0@J@㿐@A@>㿐@ΐ@, @& @擐 V       *`2 * 㿐@ث@  @͐& @p V       *`2 * 㿐@؈@ @䪐& @M S    "?#*@@ ?*&@ *0   *@`*&@ *㿐@R@ @t& @ S    "?#*@@ ?*&@ *0   *@`*&@ *㿐@@z @>& @V    㿈. .`2`@2  ??#@ ?|* b R`㿐?|?.  @ R #@U`|* P*`   |*` P2  |*` P2  |㿈N |"@@  ??#@ ?㿈@  ??#@ ?㿈@?c ?|| `?㿐|. "` S `   #@UW`0N@@   N@@ ` `` `?|`?|`?|怢|䀢|  * *` @ *  `|怢@|䀢@| *` "   2    | *  `   *+ 2+ ? | *  `  3  * * 3?|怢@|䀢@| *`"   `? |怢@|䀢@| *`"   @  |怢@|䀢@| *`"    *@" @  |怢@|䀢@| *`"  㿐@ @4$ (@  * ("@㿐@Β㿐@B@ @d& @@ 㿐@3@ @U& @@H 㿈 '耤@',``@@y @=$ @@,` @5 㿐@b@@d @(& @ː㿐`?@69@ 㿐`?@69@ 㿐@ ,  2 {#{#{#{#{#{#{#{#{#{#㿐'|,2 @ @<@ @   @*#@Щ ( @  2@ |,` @ R` ` |b怣 2䀢@  䀣@ɒ 㿐|. 6 b䀢 @߸9 `,%|  @6 @@@6 *@$@ @ R $ |b怣 2䀢@   䀣@ 㿐@z'|,2 @ 4  @ 2@@ߥ (@$ (*  @ &|,` @ R` ` |b怣 2䀢@  䀣@E 㿐@ R (@h ?#@<+| @߶@_@ޒ@Ӧ@@ǒ|"怤@ |,` @ R` $`  2b䀢@2   2b䀢" @ʒ@@$ @ 㿀 2/@@/'  2  %2  / @/@D  / @/@9 ڀ`  ր`?@.#@l㿐  |bZT      @  , `"  @_9@[+-| (@ $  @ʐ@঒  *  2 ` @"%@`? ` ,  @އ@?<` 㿀 /耦 ///|/bϰV       @  , `"  @@#'|(@ޛ %@U@b@>  *  2 ` @Һ%@ҷ`? q975, ` |  + `  R `X  "X3@m` |` 怢 |"耢 |"ꀢ |"쀢  |" |" 2 ` @?@l0 ?@@  @/ @/ `/@S@@Ω@bX@! ݠ``@? , @(@$@Z$ @>ǐ@wa@y㿈  @F  $@I $  4T "@YbR@ "@w |"@  *  2  "@[b|"@  *  2  "@Ib@?@s< "  2( #?# b@0 0Z( ?#  #8@#b0M @/ ) @ ! 7@@@ 2`  @e  @" (@@P`@*ؐ  ( @*@ #@*@ + @i&@ & @ޛ&  @ǐ@aԁx'L 'D7" 7 @P   $@ ' '////#`@c``? 1|'%` , @"+   R` @?<` `(  /' `@6/怢 ?c @B 怢@x@; *@n     @v * 2 " `2 .-/ +   ' 2=`-`/ @+  䀢`- L2 䀢 U   `(`-`. @*  䀢`- L2 䀢 7   `(ܰD. "X@ uD`-`/ @*  䀢`- L2 䀢   ܑ- L2@܁x         7ؠ n77777777@7ꀦ   J Y! ؘ  )c@#.`@ `@#؀` .` c @) @^ @@W *@  @ ` @ ` @`@.㿐`2 (@`Ր (#2 ,@6 2@b֒& ($*@ & , H  ('" ``"  `@9```2` 2 H* *@ &@ؒ 㿐|. "6 ` . `  H@``||,`2`  @r@ڿ` (`@ܼ@܁ @  ` 2 @ `  2@`$@L @4@t?  $@4@db6b &@) @ґ4@Q?$b4`  R `| b怣 2"䀢@  "䀣@zu 㿐   p@`` @_@St `  h@٠ ` "@_Ő, `"  ` ) , H ('"  `"  `@6```2` 2 H,* *@ &&$;%#@_(@, @ 2@@a&(@&@ @&, ` "  @ ֐@㿐|. "6  |@$"䀦 @٫K |!@`|.  @ R  @’`,` @72`㿐|. "4 |'bQb怣 ڐ I|+  @ R    @.  9}  @ځ  2 2`@ފ`$``@`, '@٦6 @@٠@ٻ  @٘@ٳ 2@*@$@㿈'D  \'D- `  @'` " @^, @  "@ @=  `4`  + ,  * -`@^@`"@ @^@@ "` @ @^@@@ "` @^@@`" ݢ`Р@Ǫ쀥 㿐 ' +| , @u@`@^cb[]`"@`" Tb` "@ @ " & @Lt-   @ Ѐ ' @Lf  $@@L_,"` `2@Ր" K@,   @ "@@߬  @-@L>@ߠ㿐`2 (@] ( `J @ @  @ ,`-7/%#c#|)``2`@  2 @`b䀢@@ &@@ &@ @zb@` `2` ( "& (*@&*@&@ 㿈`2 2  ` @] @F,` ` , *`  2  ,   `" %|`` * R `2`@k6``@u`` 2 @ѐ@&  @ * * @ @ *@ *  & @V &  " @V &   " @ &   @& 㿐``H@]6@@T`  |!@`#@ʒ`@~@`(   @ @@@|``@`,/| ,  `   `* 4``2` @6     .`@ח2  "`& "4`@  2 * ` a8! @j* 4@   * !H @[$@`H@* *@ `* `@ق$@@ `D $`D$`,@<@ $@㿐\./ *2 *`@   , 6@  , 224 @s @@7,` Ֆ /@+| `"`  ```` 2``2 `@I @@ `  /`@2 @㿐 , <#< `"3 !c` "%`    `2@"2`#`" "# 2 "``2` 2  ,  <+)#% @  `"& ,$`  @< D?& D @$@ 2㿐 ,0. "& +|6 b   $ $ $" $ ` 2$  @`$`$ `$ $`2  2 ,5$+$  3|1)b쀢@2`!x!@%   `$ `$ 2`" $$` 2p`H  '`D'@[[@@.|2 b䀦 |b쀦|b怦   !@akT` .#a@ڐ@[2``"@̒b @+ @ÒbH @+ "x@a@b@j@ɵ,`(2 `?#@"@"`@@@ %   @ `, @` &` @ b`@` O </'#c / -` * 622#\5 |@_ @@ $ ` `` 2` "` & |@G"@b"  & 2 |b* ` a! @|* 6@   * !H @ $@`H܀ u45 1&` ?#,`,% `D$`,@$`D@|, T` @ R 4` @9``D#" `Hܒb@Ԗ" @@ &@@ *@$@, `, @ˑ2 @ , |b*  6`@`/ !#''bА'@' @) @c@ ֐@<@@6@ ֐@<`D?$`,$`D&` @ $@㿈 @W  #@ec@#@ecP@VV  |!@`!|""@# @\`(`(@۔@ $@y^  ,/#2`  @ * @" 2* *@ &@}’ 㿐`@Yt@ (S  , 2`"* ,) `$``` ``` 2``2 `@[M`"`$```2` 2 , " $$  2 2  * $* * &@}` 㿐'L`'P @YV  ` @{ < @@x& <& @@؇ P& P@[@Ǧ@ǣ  ,?`7=77|#c-|`.` @ *`2 @!'|4`@  @@ @$  &@ @’@ǿ``2` 2??# y  @ @ 6 @&  * *@ &L 2@|  P@P@uk P @{㿐 (@  @Z* & (& ,`//!#@$@"#$`` "$` ,` @"` ` 2` `2 @@] @"@@  $`$@$`` `2@( ,`'7` "`   ` @ @@ $@  2 ` `2`@ * *@ &㿐  @X` V@ \@q \ | @Ԕ怢  @ǀ @@@}  @r֔ @R`@'`   * @Z2 ```  X "X "X"ؔ#h@Oc`  , ` 2`Ā * 2 @Ƽ `*`2   @@v@Z @!  ,< "  (0@2-   @   "  *  2@   /` * @ 2 2@  @* @D```@&`  ʀ A * &@  @  `@ 3)|9|` /`@" . R , !@ "  @ސ* 2 @A @* 2 @:@7  ` 4 @1@. ``@&` @ō `@͐@{c @֢@֠@֞㿈|.`b6` .` R `< @|* 2 怢   @* |2 䀢  @* 2  " @* |2 䀢  @Y ,`2`@w* 2  @ @k 2` @B   2@#\  @D㿀|'L.`b6`@+'@ & ,@Ѯ @| b @ %|.` @ R $,  @ "   2,  '@, '@L2*@%2 @&@怤 2# @6 '| ,`@怢@ꀢ@  @ @ @R `@&  |,  @  @ n @ .` ,`怢Z`|"ꀢ U 7 @3@ג@V@ |"`  @ 怢 =  @@м@;@  ) ,@@Х@$@  @@Ж@@  & @& %.`@  '|.` ,` 怢@ ꀢ@ @ʓ4 @n@ @ĵ`@& .`|2   @Y@ؔ@Ġ  22 @ė 怤 耢@9@ѯ2@ x@U.`|2`"䀦 o@v k@!|@"怢 ]-`@Ɛ. |"`   '7'2'R |!@`2  |"ꀦ 4)@` , +`2 #@c, "2   @ .`* 4  '.`"2    @Ѱ * 4  '䀢  @h -` R2`@yL 㿐  ,@@ ""`T&`   ,@ T`4 `$ T& `@ @  "`T 6, `2 T@TÐ "@ $ @T "@" T?$ T2  @t @&@@m &@z@@S&㿈 'L  @E  `2@T@;9쀤 1-+), @@ #@R  #@  #P@ c@Qg@ &V 2!`  ,   @@G @ː &0@ΐ @@@ `2  ,@Ҟ < @@қ& <& @@Ӫ P& P ,   2   7/#c, @ @u @@` ,  `(/+#@ @ @$`"  @U@`` 2`, $ 2 2  @#$   @@ @ @&@@ @ @& @ * @&@ * @&  @2 * * @&   @ @ *`* &@ " &@ "V  &V T`@`6 `D D@  H& D`H @:& H@ʰ&N@ @& @ 耥& & 8@L @w 㿐@ϡ@Ϟ @Qa  #@Ғ`#@ҒcP@P/@ @QL " `@ (!#cP@@P@``@ @&`8 (@~`( @Ik@~ d 2 2  2` 2`   `@L "   "@T"     $ @ , D& ,& D "Y@@ P`"O "K @a|` "E , =   25  `, ` `` 2 2`  &`," `D "<@&`D`,`"  `""```2` 2 2 2@*@&@@2@~А "  @Te"    $  2 $@~`,`D&`,&`D @J & ($  " ** `@  $" @~B  *@$ D`D ` , `,  2 " $`,`,  ,  2 " `, & ,   p@`   @ * @&@ * @& @ * @&@ " &@ * @&@ * @& "@   2 ** &@& `@ @& `D D  H& D`H V & HV` `6 @h@ސ㿀7<. c6 @@).`6`@$@,`,2 2@z @*|b怦@P N,@  ,,2 /   *4 @ @Xb@ @  .` `@G4 @@ ܓ/  u- 2  / @ @-b@ݔ & 0`,b2  .,`- 2    *2  2 J,`-2 2` , @@ @ 2  @ @@ & 0-2  *,2   -2  2 -2 3  , @@  2   @͒@} & 㿈. .`6 6`@ @g|b怤.@ @X! ,`?2 c , @@ @2  @ @@; & 㿈.`. 6`6 @u @%|b怦@. @! @,`?2 c .`@ 2 ` @I@`@& 㿈@j @m @l @@ @Z `@V` * , 2 4 ( @>  @ @ |"@v& @͵  &  &    & "  " & 2 "H &HHD'썠D'셠ɦ쉠 @!u(@!o( @!(& ( % @! @   @  ** @ %``    *  @ @  ""$`-@,` @(`@%$`-@@ `$`22`7#*` @@I%F@P & ` @!: @!4`@ "`%  ` 2 ',` $%@/ &  %` "2 @! @! @ "`%   뀥22`*  @`@`2 ,`` "$`@ $`,`,@2@ *@&@!  26 @=@ Ð @A `@s @ǐ㿀'L'T@h'X@k @k @' |"@/& `@n   &  &  @  & " @ " & 2@ " H & H`H D'`D'ɦ @ ) (@ Y`(& (%` '@   @ @  @** @ %@``  /T "  "4"$0 @ܦ`@7|<8쀢 @:'@ @ @/ @ @$@ "$@u * 2  " @K̐@đ  $ $ܦ`@7|* P 24*` @8O2  P@M P"4,` @/* 4 @;* \ 2 Ġ@$'Ā "Y` D@  2 N` J`*'@(0448@X`- 2`P`/ 2`@8  P@P"/ 2 *`@ X\=Ġ@B$@'ĖD@  2 @= ˒$8$($0$4``2@``2` * H@"@ 2@P` b'쀢 |@[|Ē @{   @  2 @_D" 㿐@X ```0@1 3|` . @z b* 2 ` `  &`   3|` . @t b* 2 ` `  &`    !@=a( X`'L''P'@t'܀ @t "@1 @F   (@3b#@3cP@E@ @F  b@ (!#cP@@Ez@bP $w q  !#a8@@ah@a@a@aВ  y@`@ %`D D@@ؒ @ @6Ȑ  @@6Đ  2$@ $;|$@ `-7|5` ,@@* b2  P , +   `2,  2 +  2$@%$`&` P#`#d#\ @6y  2`(@w"(`( @ ( @ %(@ %#\#`쀤@ ؑ,` `@C@$,`@5ڠ @5@5@@#@! @  b ,  *   @5 & b*  @5@5@c} L @k 㿐 ||_b  @k @a @  ,` `@" "`T @ ,`   ` " @d T@`$ T 29 @r6.,@@rm` T ?@f T& T T ?@]$ T2 @l װR" @5%/  ,`@`@2 ,`?@`@rw@ru-2$ @kߔ$`  T ?@ T& T T ? $ T@@"$@rJ$@‘,` $$@4@A@@8㿐@  ` 6# |` |" ` * **`@ R` 3 ` @@ "  `  * 㿐'DD   |eb @OED@ 2|`2 ``@FZ@`@@@j !@`$ "@-'#%`,` R $` 2 `8@א@Ԑ@ђآ`@&` @! /-'%`,`@@  @D> " ` P@ P@䲐`@C@`@&` *` @q@@bΒ @@@q@bÒ `|@.@,wD@4-   ` @b?$@$T`X|@#  X?T @qH`T @qBښ  & T($,  $#  H H D D   ? ,  $  `, $`T `@Đ``T  @ @3& TD@ @@㿀 '@_5'@qQ  @EJ?@;@Q  @@@+@% '@@@R 'XXX`?#`ct@&@]@[㿐 , > ( `6/7#c`2,`2($`@  @@$ @ @$ "$`@F`""` @   2$```2` 2 *@$*@ &㿈'H 'L'P@p'T  @D@OdH !`(@| @p䀢 L  @D`(@@NH :L` @3`(@ݐ`,   " @Œ 2 @¢@*@$@%`,@``@"`,$* 2 $ @   %@PT@HT $@h @ @Bb  #h@Ӓc#@ӒcP@A0H@ @BL "H #h@c#@⼒cP@AHH@d @ @`HD`D@  'H'@H@]H` @U@S @( `@$` * , 2 4 ( @2 @î'@#@#ȸ  @&*@ @ &* @2 H* &`(@(& (@` ``@2 #@242 `@1#@2(@% @   `? ** @  %*@ @ %``"` Ħ  *     "" $-, @@$-@$2*  `)`"& `,@.@@ `,@@@@``2@2`-c3*  ``"%O, L 2  @nϐ@@@Ē3$0`@t-$`"7  L`2 @@ @n@@@@ 2 7 % @&$,,20`L 2  @n}@@W@rL@ؐ 2 "<@@0ɐ@w@(L`5@Ғ` $%`,  <# % %  2* % % ,% `,& ,`D D@  H& D`H @p:& H`& `%`& @%`P@m@`& @`& P @H  @mH @^B@.T`2 H@fz  H   "  ` (@`P@޷p @B@B ''Д'#  #     >'@A'Ԁ2 @A'В  -'#@`X@/ ؒ   m @&@h耢 '@%@J`@; < @@8& <& @@G P& P & 8@e   ,  n @e  @&`@=@5P!@<@  '''D''H''L'P'T" D7"`'""`" "`  @ '@m'@mH@U @ & D  H @  **@  &D  H@ @  *`* D& H @  + * &D@  H @  * *6  H&DD D@   'DH@D`(H@(& (@ '`'@L&` `<κ*@ -/`T  -7 @/  T@ T"*` 2 4L PJ\$ "  @~@  2 2@:@|2"-T2  Β + @/O2  2T@M T"- 2 *` 2 4L P\$ "  @<@W  2 @C?/+ @_|/"* 2 T  5@/  T@T"@*` 2 5 L P\$ "  @@  2 2   @  @**@ &@  @ @ *`* &@@P 2`@6@@kH|@kD|@  D@@ @&& H @& @U ``@d/ @{x@k >@kݐ 9V  V` #`(    @#@!` 7@O7椒 @.W  #`@J@@@:#` #\@@ @ | ,  * @  @-& |b* @ @-@-@2@@㿐@>@ & & @m `D D@@`(@0 (& (  " T @ "T  &T V`@ `6 6  " @ " & " @ " &  /@ / &/7#cp @>&   @ *`  &      & & `" @`@`@`"``* 7``2`"7#c`@@f`@`"``* W`2 ` & @&``2``  ` `* 7``2`@ʐ 2@o`@bʒ 㿈  @`  4 쀤@   ,`@jf `@ @ ! ,`` @@ @`$@@ $ @@@`@&   耦`@ݐ@Q @,   DD@   @k͐ @i +,  D D@  @k@i`쀢@"$``耢@"$`@<ڑ,@,`@㿀 #|?b'@=Ր'  9@=ː'b'  .@='عb'  #   @='V` !|!@`!#a@F@Ba@>a@:b@6b @' 㷔 '  T` !|!@`!#a@@a@a@b@ b @@ ㊔ T !|!@`!#a@@a@a@b@b @@' b '  'T` #|!@`!#a@Đ@a@ۼa@۸b@۴b @\@b' 3 'XXX' #` ct㿀 #|?b'@<'  Pb'@<ߐ'  E   @<ѐ'b'  4V` !|!@`!#a@`@\a@Xa@Tb@Pb @' є '@<'  T` !|!@`!#a@2@.a@*a@&b@"b @ʐ@ ⡔ 'V  #|!@`!#a@@a@a@b@b @@' w '  箐T` #|!@`!#a@ڐ@֒a@Ғa@Βb@ʒb @r@x' I 'XXX' #` ctx #|''b'@<'ܒ  db'@;'ܒ  Y   ,@;'b'ܒ  GT !|!@`!#a@s@oa@ka@gb@cb @'ؐ  '@;'ܒ  T` #|!@`!#a@D@@a@<a@8b@4b @ܐ@ ᳔ @;'z'ܒ     @;q''ܒ  אT` !|!@`!#a@@a@a@b@b @@ s '؀ '@3X-X.5X @D3X-X5X`@ < @@$ < P@$ @ $ P $ 8.   ؔ  @_^@ &`@@נ'T` #|!@`!#a@٣@ٟa@ٛa@ٗb@ٓb @;@A'ܐ  'ܒ  IT` #|!@`!#a@u@qa@ma@ib@eb @ @   'ؖb'` 'ܚt '4x #|''ՙb'@:'ܒ  @:'Չb'ܒ  @:'~b'ܒ     @:s'V` !|!@`!#a@ @a@a@b@b @'ܐ { 'ܒ  岐T` #|!@`!#a@ސ@ڒa@֒a@Ғb@Βb @v@| M '@:'ܒ  ~  S @: 'ؒ  'qT` !|!@`!#a@؞@ؚa@ؖa@ؒb@؎b @6@<   '؀ '@.-X%X.5X @B-X%X5X`@< < @@9$ < P@H$ @ $ P $ 8.   r  @]@ &`@C@:T` !|!@`!#a@?@;a@7a@3b@/b @א@'ؐ ߮ 'ؒ  'ܢT` #|!@`!#a@@ a@a@b@b @@   'ؖ'` 'ܚt 'ϐ㿀 #|?6b'@97'  䛤@9-'&b'  䐐V  #|!@`!#a@׼@׸a@״a@װb@׬b @T@Z' + '  'aT` |!@`!#a@׎@׊a@׆a@ׂb@~b @&@,  㿀 %|?'@8Đ'  (@8'ӳ'  'T #|!@`!#a@H@Da@@a@<b@8b @@' ޷ '  T` |!@`!#a@@a@a@b@ b @@ ތ 㿐T   @8S&`0`0        $ ۔  ֐k`Q@ @@0` ` Ҍ . `"@  `. `@ 2@e'@@ @y < @@v& < P@& @& P& 8@,   䭔  @@@z   @y@d|b    ( `?@ p| ' 'ҵb'Ӊ'ӆ @ V` # |!@`2 !#a@F@Ba@>a@:b@6b @ސ@@ . '2 '{b'  V  |!@`!#a@@a@ a@b@b @@ ݃ 㿐|.b.   6  6@ @.`6`` ?#@"@3, < .` 2 ` + `?'P*! @`@+  @` `@+ @2` ``@+ @2``* 2`@ Ȳ6 0@t@rAx@A(AXAxAxAxAx㿐|.b.   6  6@H @D.`6`` ?#@"@, E .` 2 ` *`?0P*# @``2  @#` *``"*   * ``"*  **@2``@2``* 2`@ 6 @@C`BBCC`C`C`C`h|.b.   6  6@ @ʐ.`س6`  '耦` '?#@@C, BГ.` :`"R  *  `?,Q*#X @ `2 @!` +`   +`  `"+` +`+`@2``@2``* :`@ ²84Ȑ @ V` #|!@`2!#a@Ԉ@Ԅa@Ԁa@|b@xb @ @&'ؒ @ߔ '44'|оb'  (V` #|!@`!#a@T@Pa@La@Hb@Db @@ Ô % 'В  '@w%@@ EXDDEEXEXEXEX㿈@բ @ @`  ,` 4 @ @` *`2   @`,``}=7)|#c|   +` R` 2` @  d*` @2`"4@ @V&@`@  -*`  (*2 * `( @Y"4@ $@@ @6&@(@L2`4 "@"4 *`*2 !*  @2(@22`, 4 "@"4@ &@*`@ޓ2`@ $@2` `2`@7@ *@* &@p@"  .`  6`@Ұ  ,   @)2  l+| 75,  2`b  * S ;2N  @ *`   *` 2@"    2  b  *     *` 2@"   2   + `  + ` 2@"  @@yҒP  * 2`@ @ |:b``Q, |` 2 b + `?5S*" @, 2`З4+ ,2`482  + ,2`42 ؘ " " ''@#a@Ҡp  !x@yxaP `* 2`@ @>Q "@4@i P#& P ''"'@3֐''  ` '''  T @O @@> @W @DMMMLLMMM`㿈'X@W@7. 6 @*  @3@@ \@@Ȓ\ @Mc ,  ;/ۑ*`-۫2  >  @3j$$ H?$ H@@u.@q.`2`@  @@K 2 T " T 2T  |+  @ R $@ * 2 E @3 $$ H?$ H@@),`@%,`2 @Ⱀ* r2   @  @6@K? 2WS2K@ * 2 2D @2 $$ H?$ H@@,`@,`2 @U* '2  Җ @A  @@J 2  2 2"  2@ @ڐX 2@Vɒ  >$㿀 '@2w''  '     J 㿀 {''''ȟ    㿀 '' ' ݳ'㿐 @: 㿐  @y 㿀 '' ' @'㿐 K 㿐 @ 㿐  Y 㿐V   |!@`2!#a@Щ@Хa@Сa@Нb@Йb @A@G @ 㿀 '' ' @'㿐 @x 㿐 ﯘ 㿈@z4㿐|̼b㿀 @@$/!N`/  N % / @S@ N/ @@N ?@#@(㿐!|"@G@+"` ` *  "  @v`8"@i@İ@$㿐`2 (@1[ (!@@] 2@@3\& (@&@*@ &@U 㿐` H@16 ,  (%" ``"  `@```2` 2 H* *@ &@UQ 㿐@ `@1!|"`"@`" "` "\@㿐V  #|!@`!#a@σ@a@{a@wb@sb `@@ 㿐@0@\ J@T @J`(` ".@@@@V @t` , 35?    @Hߚ  @0 @HԚ 2  @@ǐ@ @  @ @T 㿈 #\ < 㿐  @5@9(``@0B@ `@ < @@& <& @@ P& P& 8@Tu   ,  @Ti  @&`@@̫㿐XXX#`閚ct㿀 ''    ߘ   1'@/'䀦 @/'   '#@{`X@    ` @ @@T㿐`4@ @ ,`툔`2`@`@&㿐 { 㿐 r 㿐 i 㿐 ` 㿐@ 2@@&@@@n  @ * $  5|@ * 2  " @@1X@  㿀 '''o'XXX#`ct 輔 㿀 ''Z''  ڈ㿐|b㿐!| " "  &㿈!|"" @s`(@`(@+㿐|b㿐.`6`  . @2  2$@t $㿐@< ` |` ,  *   @`&` |b*  @@㿈. |2`@ۻ㿈. |@۱2* 2 㿐 `@@ @ `@` * , 2 4 ( @0  @t/ " * @ @ H`H D`D   ?㿐r m  !#a8@@ah@a@a@aЁ㿐@o  @s!@q]@q& & @J!@& &`? & @Y0 @Y0 !@sa㿐@}[ @}Y @ @I㿐  Y`x@qd`` &` x@qY `& ` 2` @ @q@ $ $@8 $` ` 㿐Y @q5x   "  `"& @q@ 㿐@ 㿐@|`   ?㿐@r/s# $   @ *`  $ [ `5 |"*  ``   *`  `?  ` `@`$ $@d  @a@^``|`2 @ 2;@$ $@?  @<2 r 2@㿐U  V`  !@rb@k@i@o @x @++|1b,` ,`@   @ , @1#4  "`R   D `(@ `?`4 @1c `@&b@FĒ@I @I @@7  @  * 2 @/``@ * 2    @2 & @d  @a`    @$ & `( (& (@=A  `?@XN@@@ @PҒ 㿐 W 㿐< `#?#@2|#@b0|b䀢   " ?#@ 2`( "@  @ `d*`!  * $`@ $@@Г, &@q" 6  *"@   ' 23, `4 @Y@( , "@3 /|#+,2@ ?#@ `2)   -2 @ $`$@/ 0'@2 @' '@ @$`z$@@X` -2 @ܐ @ $`$@@$ $ /  2 @ '@ @$`$@@c2 @' @ $`$@ ` 6`@  @  `     '  @ ` "q p  6  퀢 6 @- '  $`$  $`'  T 㿈 d @ '耢 '@q "h ,`"M`D%`3/#   27 $耢@*` `d@ɓ,  '@p 耢  @*"@ @  $@ `$,4 @Ґ@", "@$2` `2`@D 1</+#c#,2 *`@ "&@  2 @@ ( $ @&2@@ (*`2 ئ !@`h@&@5   `|"` + *``  RV @6   `&` 㿀 @  @'* @O"@  @ "@ ' d d # @3'耢 '@p1"h #? z> a^ @: " * @*`@*` 2 .@@ D!/@[`"x@@ @ݒ@T `&`$  ,  ?#@ ?  "4` @ $?:``?$`"@`@s&@ @ % @ "*%@ @@@ #@ @@ `  ,  ?#@ ?  "4` @ $?:``?$`"@e s &@)`@"`@Q@N 㿈 Հ # cm `!*!**<Nc ^ [:Z4*` :`@Ơ N O L**`I4<Nc B ?:>4'`02 NN  2N|"%4 ? N  *`|"4*`:  ! %" ,բ?@ @Մ44  N   ʀ`04c㿈<c#(L` f `"d6*: L "  " L U S %  L      L    2  ,J 0 ?2 J|"%6J ?  *`|"6*`:  !26@o} @֛ @6 ,:  , 6㿈?#1#% !c(@#H T#LJ@ `N#L|'#L@ c(c@#H eLJ@ a!֢  g ,< # *2`@դ L2@,`L?2 c  , ,2 @ 2  1|,`L4 @Ն"`L*22`  $,`& , ,2 @  )| ,, "2  @e,`2`L2 , 4  ,@`,`L2  2@㿐#  "#H!c%@'$#L @ݐc$, @ِc#L $( , `2^@mϐ"^n"(%H@RL@P ,@Nc(㿐'D `d   8)  2- d`8 2`4 6 %;9(|  *` R  -D: * @ *  ` `2`*`#@  -|62` (`*`(2`䀢|#( 0"怢 `#( ?*@(`  2 b@1  #(*`   "@%  #(*` #( *@ `` 쀦``  (`*`(z2i#(>* #(@Dl l@ 㿐'D  @9|7|5|;D ,`"@ * U` 2 䀢怢`m ` b@  "   2   2 `[ `  @  2` `  b bG`C 1/` ,`@ "*` 䀢  怢2 `& "@  "   2   2 ` `  @y  2` `   $U`@&` @}%`㿐 (@7_ @a# @Şc0!쀦Z !##H%@$ d  $`l#@K $(@lI#X@@Ð |@l<#X|$ 4 @`dƀ@`d@#`d@Ѡ"  ƀ @w`d 2  @`dc(@%l쀦*   %|" * *` S  #  6 *@ * ` @"S & & 㿐%  "#H!Ր#@Ц$# @̐# $c(`2a@kĐ"ac!p%#H@G@E(㿐a@H㿐a8㿐! c(  H###(@ #(J` "cH  , 㿐  Š * :    & l@Y 㿐  * :   "@kZc㿐  @%| .``` (V& @6 .``( & V@& @& 㿐 +         * 5*` " @W* $     ?"` "  "` " $ cp@k0@  ?@j? @w$$ @w $ @ $ @  &$ 㿐#@k@k@a  @jې@Z-   @jԐ & &@& !& ?#p@j@F  2@j@wJ$$ @wG$ @Ґ$ @ϐ,`$ `@$ 㿐: @4 ?*`@ *`         * 5*` " @* $     "  "` "  "`&@ґ*`%  &㿐`@@6`` ,`@4,`@:,` @jS#6"&` ?#p@jv@ɐ  2&@jC&@v͐& @vʐ& @U& @R, &  $ &` 2&@* ` `` * `    ``  * 4*` "` @K* $`     `?"``" ` "``" &@㿐 2 @w ̠ 2@i#Ȑ @  2" @ P$  p @vl P$ p@w t @vb P$ t@w x @vX P$ x@w Ȁ  d@u 2$ @u |  @t+ $ |@xh  @t  $ @x] @v- P$ @we c    @~ P$ @~ 767#`6 c$ L$ P$ $ h㿐 @ @v" t@v  x@v p@w |@w @v  "  @v@v `@  @@, @@א "  @u@u `@  @v@, @p@ ( @  *`@` @u@u  @ `@T@,`@N@@*`@@ ( @  *`@` @u@u  @ `@*@,`@$@r@*`@l@j@~  Ā " @ Ȁ @t@Zx. #|2 b  ] .`ऑ2  G@u  @G耢Mܢ @I@;`&@  @~@,`$  @~@)'`& @~`@ђL@b*2  |7b77ܒ@uy`&  @~@~܀`$  @~a@~'܀@4ܐ$ @~@~㿐    .`. 2   .|6 @ R +`|6b怢  @t0-+`|2 䀦 '|"쀦 #|.  @  5|怦(,`2 #6`6`怢@,`@tő2 0@t’㿐 5d  @.|b4   .`.  2 @  ,6`@ 4 ,-   2 , @4 4  @ ,4 怢@(- (. |2 䀢 0|"쀢 ,|* @  `    @k,|b2  - , @2 0 2  @c0@ȵ 㿐 [  .   @|.|b2   .`,`2 @  |6`  @n 0w@| <|6 b  0怣| ?@|x  :+   @m  :@|l6`b䀣 0怣| ?@|` +   @m @|T >0A. |2 䀢 ;|"쀢 7|*  @   `*  .   @|1.|b2   ,`".`2  @m 02  * @| ?0"  @m x'?  L P '`''$@2 @|+`"2` |"쀢 |* @  "   " 7  " 77@t@`$@, 4 * ޑ2 @@} ؁㿀' P  x'>ŀ|,"2` 4|"쀣 1 8  |+   @m3 $!|+ " @  @l/*   @ ` <2  ` >  ",2  @m @t  8 @{y x?    L P` ''''$=#|  ,   , 2 @b+`2  |"쀢 |* @  "  " 77@t:`$, 4 ŀ* ޑ2 @@}8 ؁㿈 x   ` L  P/ '|@rӔŀ* 2  |"쀢  |* @  7@r@ * 2 @`ג㿈d'`  "!" x  \ `? (`@r@r ?0``\0 @@;`\0`\㿈d(`  """e x "` `? +`@rQ@rL ? `eYb` @@eb` \b` @zh 㿈d'`  "!"e x   `? (`@r @r ?0`e`0 @@e`0e`㿈 v d(`  """ x   `? +`@q̔@qǔ ? `Ԓ` @@v` ג` ` "`p ?`` *    L P'' '''% @|+`b2   |"쀢 |* @    " 77@r`%,2  ܐ< #  7ܑ,2 @ ||,  @ R  |"怤  )7'7ܑ,2  !|"쀣 |+  @  `!|"怣 5`,`2 O5`5`"怢@255?#$ؤ ``  ```` 2``` $@2,@ݑ2 " "`$@{A e "㿀  `` *  x  Ĩ  z'?3|#@pД@p̔< #  쀢 7 |b+   R`|"怣 2`&7|,2`"䀣 |"쀣 b+   `'|怣,`4 4 怢@255?%` ``  ```` 2``` $@,@L2 " "`$  "x x   L' P' `` *   Ā@  '3|7|/|@p>@* b2   쀢 *  `b7@p%ܟ@ < #  7,2 @ +`4   R` ,|4 "怢  '7%7,b2  쀣+   `2%|怣+`,`2  4 4 怢@255?c %` ``  ```` 2``` $@,@2 " "`$@m "h ? L' P'  * @   '' '''%<-| # ܀ ,   , Б2 @+`2  "7|"쀢 |* @    " 77@p`%, ̨2 @   7ܑ,2  ||,` @ R  |"怤@  )7'7ܑ,2  !|"쀣 |+  @  `2!|"怣 5 ,2 =5 5 "怢@25@5@?#$ؤ ``  ```` 2``` $@ ,@ˑ2 " "`$@y/ T "㿐  "9%  ֐@k,<-+)'@  @k"@k⼰ @k<@ ې@k ې@k 2 %㿈  O@x`@`@ @@ *|2 䀢 |"쀢  |* @   (  $% '|%|5|@w?@`* 2   쀢 *  `"   @݀  x`?`E C ?@w @* 2 `,-|+|)|@wܟ@* 2 ԑ, 2   b쀢 "*  `" `ݔ`?p''  `( L     '@ ] |*"  `?   <@  H€  @m@mĐ?c ?  @ ؐ l@'@ ' ɒ9|'|`ƀ ",  2`   2  *` @md , @m, |2 䀣 |"쀣 , - "+  @ @! "@v͒܀   '@wC'| 4 @ < & <r 4  `"U?#@ 怢     *`    <`B怣2  .  4  <`+  @ 2`"  @v耢   ,`@v`` `     @vS <` & <@mC ' = 2  I ƀ`|b,  2`   2 ,4`*` @m( `@m`,  <*`, 2`@|2 䀢  |"쀢  <?& < `' <@l@v   2 Ԁ#@q`؁X L ' '' '      ' ''ؘ' '|*"  `?   <@  H€  @l@lD?c ? 2'耢 Ȑ l@''+| b,  2`   2  * @k , @lI, |2 䀣 |"쀣 , 5 b+  @ @ *@uVԘЀ  @ؐ '@uȐ쀤 4 怢@  < & < '4  `"W ?# |"怢   `  ` *    = `F|"怣 2  .  4  <`+  @ 2`"  @u   ,`@u`` `      @t' <`& <@k@쀥 Пؑ* ?2 c #]0RА * ԟ@2 |,  2`   2 ,4`* @k `@k`,  <̕* , 2`@|2 䀢  |"쀢  <?& <@쀢  <@j @t "쀢  2 Ā`#@Ւ`ȁ㿐|.`"6``      `*`.   4   @t |# ,  |4 "쀤  .`|"䀤 ` x@j@ 6` * 2@ 㿀T   |*` @  ? <@ H€ @jV?@j{?#@ ?#2  @l@   ;| ?* `@  @3   b* b*` * ` b怢@7|  *T@  *` `6`,@L€|+ "2` |"쀢 |* @    + 2`/J怢@2 + .2 <`+  @ 2`"  @sz耢  ,`@sm`` `    <x@i&<` ,<&<`&`E  6B'|`,@L@怢@2< + 2  "<L@*  2 @$<L@* ` 2 `"<x@i&<` <&<`&` 6 ,@L@* 2`   2 㿐!{ #耢 # @P`. #2  &!{#쀢 # @Ba#쀦!{#ꀢ # @6`#ꀦ!{# # @*a # 㿐!{ # # @a8. #2  !{# # @ aH# 㿈{ xc   @h %c`@h!| L€ P@",` 2 ` @a  -  ?  <  / ` >`?"l 0 8 g, 2`  " h` 0 b& h ${c@ "c$@iccR@ic M?`   @pݒ? @@$c"c@i c@hd & *ax@,!X@W < @p @bC*?c` 2$0 P@* 2  @b- 0  0 {"c$㿈 2 1  2#a@ 0  @ :` z@ Z @@ @ <7@   H€@@f"@g@F  ` `` ?#2|*` *  `f d  | *@ |"*@ *`  *   *`  @ 2A ` @,`: 5? |# +`ꀢ ) 2`  |"怢   `  ` *    "   @U 2  x{7޺ ##`  @ÒaH{.`2   `?2  1{#耢 # @}`#* 1{@#*`#쀢 ' @na#* 1{@#*`#ꀢ ' @_`#* 1{@#*`# ' @Pa # *`  * '   6ز`?ޱ*##|`19,  *` ``4 `` - T`w- <  ( 6 b *  `  2  @ `?      ?&?<  ( 6 b *  `  2  @ `?  _     ~X<  ( 6 b *  `  2  @ `?    6  ?'?<  ( 6 b *  `  2  @ `?       /`?!X@(ax@S = ";    &7``" `2- #a@Ґ{c c @RaH{@ 1{# # @Ba8#@~ c@aȰ 㿐!{# # @-aH.`#2   `? ?#`1+{.%|c耢   c@`.`c2  2'3{<  ( 6 *  `  2  @ `?     ?c?cꀢ c @ߒ`cꀤ2'3{<  ( 6 *  `  2  @ `?     ?h?c쀢 c @ac쀤2+3{<  ( 6 *  `  2  @ `? ` `N    /Gc c @ya c2-<  ( 6 *  `  2  @ `? ` `    `? @a@ @b0 "   2  c 㿐 <@ @@ꀦ !{#耢 # @`.`#2 @ 2-!{ < !  ( .?2`#@| *` @  ` 2   ` 1  ` `?     ?o?#ꀢ # @ޒ`#ꀦ@2-!{ < !  ( .?2`#@| *` @  ` 2   ` 1  ` `?    | ?s?#쀢 # @a#쀦@21!{ < !  ( .?2`#@| *` @  ` 2   ` 1  ` `? ` `E    "=# # @la #@2  < !  ( .?2`#@| *` @  ` 2   ` 1  ` `? ` `     `?  l@ <&㿐 ` x`` `  . ?9{2`# >;t | *@ |"*@ *`@  * @ `9{%;t-|, `@*`@@"<*2 @c&<@@dD<&< `, # 6# ,   * @c @@d% & #耢 # @` #` &c|` *@     5  *  @  6   **  * !{#쀢 # @a #` &c|` *@     5  *  @  6   **  * !{#ꀢ # @L` #` &c|` *@     5  *  @  6   **  * !{# # @a  #` &c|` *@     5  *  @  6   **  * j!{# # @ޒa8  # &` *@     5  *  @  6   **  * 1!{# # @aH #` "`` *@   0 50 * @ @   +`+  `@ +`㿐`xL?. -|# G '<@ * @@ @6 6  "l@<&   6   I 02, |2 䀢 |"쀢 6 $  @ 怢    *`     <3    &< ,@aՑ2 @@bU 2<?&<2~㿈 <@  :` z@ Z @@ @ <7@  H€@@_Ē@a,@<@,@< '`%( ?#| * @   2    1  ` `? l@<&@㿐 @}4`1  - @_ !|- @j !|* "4`  ` @Z<*     <  / ` >`? "4`  "` & 㿐  `5@|7@u  #|   ,@ * ,@% * b2  @Y` & & b @ (` @?`b0@@ @? @c  M   ,@ !|,@ !|* "4`  ` @Y ,  ?  < `  /` ` >`?`4` ('@Z! %  H@?H`@ &  @@? h@bP㿈 4<#  `?   d x7@_'|@S 0  ``@ ` @`?86|@L쀢 /@  * |+   @Z)  '2`@Hc` @hԒ@h?#@2@_u& <@_|& <' ( & < ?#| * @   2    1  ` `? (3  @  :` z@ Z @@ @ @ &7ꀢ@   H€@]@__쀢 ?#@_g?% l@@hj@h@` p 㿈  ` t x L@{ P|b  * @  `?  $ @`$ ?? @_  (@`` [?+|#@ + 2  @ b怢     *`    (+  b怢@@_b   * @_Z2  @  `  l@  @_q `"2     2 :     $ $ 㿀'  L P t @{B`|b *`   `?'@r 2)@ @! $2 !#`0@`P $2 !#`x@ `@  " @a2 @@KՒa@@KВb8@!$@a @ ǐ@K’b| @Kb!$@_`(`"ְ  |* b  `?   <@  H€  @^?@^Đ? ?#2`@@` @* |2    ?#@/|- 2  P@ 怢     *`    ;@3  / -  2  <`+  @ 2`"  @g耢   ,`@g`` `    - @@^  < * @^2  < & <|2    `2  @2 2`2H  `* @]2 `2;  㿐   "" 9`?` Y(0& h@@ #tc̔x #,ch& & & & ` "   @@#@b`0Ґ& h㿐 @  @$ `@#c@O`, `     ? @@  &$""2 " $ ` !#b@s@ob@kb "&@P&& @yc1&  ! $2 !#`0@L`P $2 !#`x@=`@8  `  @ ? ` @? & @ 㿐 x"  t"` "  Ā`=& <P   @4 ?*`@ *`         @* 5@@*` " @f3@* $    ` "  "` "  "`$@ґ*`& 㿐  ` 4 ?*` *`         @* 5@@*` " @e@* $    ` "  "` "  "`$@ґ*`&  `&`&`@= :?,`  `&`&`<`        @* 5@@*` " @e@* $    ` "` "  "` " $@˕,`㿐`  ```? @&`@&`@R@@  @C` &`T@ ` "&` ` 2&` `  @&` P`2@@ @"`P@ P`&`@[ P&`&` `#4&`\`&`H&`X&`<@@k` &`D@@8` &`Dh &`l &` `H!4@ "``` "`&`H` `$J`B`@1&`@@  @` &`T@ ` "&` ` 2&` `  @&` P`2@@@"`P@ P`&`@[G P&`&` א``  2 ``@ 6`` `@4` ?*` *`         @* 5@@*` " @d@* $    ` "  "` "  "`$@ґ*`&`㿐 @@ F +). ` @ $     . @b@NdcP`""     . @d@NQ#` `" @2 `@"@      @F 㿐h`` `` @e@P&``@@  @` &`T@ ` "&` ` 2&` `  @&` P`2@@@"`P@ P`&`@Z` P&`&` `#4&`\`&`H&`X&`<@@ ` &`D@@` &`D@> 㿐@@1  2@M#@(*  & @M# &@ & &  !4`H,`  @ $ `@   ,`@b"@M#P0"" `@  ,`@d"@M#0`k  *``?"`&$ $ $ \$ Ā$ $@ 2$@Me#$$ $$ $ ` @9 $ T  "$  2$   "$ $  P`2  @"`P P $ @Y P$  *   ?$ $  2$ H$ H@&$ l$ l@ h,`@#㿐   L  $*  & <  @K`( & Ҫ     @     @* 5@*` " @b@* % ` @ ` ?"` "  "` " $?@  h $ 2& ?$㿐<c6?c R (? #@"#  @ | *`  |"`(|2 b*   20(*2` 2`|"怢 @ 3@`h|* b 2b @ 0?#@2@@"0?# >`( ||` @  *`  `3((* 2+(* @ *"(*2` 2 怢2@ 0b䀢@@@&@  @    `@J`h0F@-    `@J`09   @ 22 @ |||"c|#b  ?  #@3|b*   @Q @@ 㿐#p@K@  ?@K?@X$$ @X$ @a$ @a$ 㿐   @X @X  `@  @a@, @a@㿐         * 5*` " @aw* $     ?"` "  "` " &㿐 ( @  *`` @W@W  @ `@aH@,`@aB@@*`@@㿐  @4 ?*`@ *`         @* 5@@*` " @a@* $    ` "  "` "  "`$@ґ*`&   ( @"" 㿐   %, @ @X@  , 㿐  `, `  @Д` ,  @{c0    #@pc0`@WP  Ӗ&`  2` 㿐`#4&`\`&`H&`X&`<@@` &`D@@` &`D㿐&``#`#&`H``&`<@@` &`D@@g` &`D㿐@  @, & T  "&  2&    & P`2@"`P P & @V P& & 㿐    @T?& 㿐 [(㿐 ߀  Ā 2@& @$   " "" `@z  @' ' ` "`㿐` `< <@V 0c6㿐  ,   " (@ & @" @ 㿐  ,    "` ^ & 㿐?& &  @ 㿐 6 ,    "` ? &  *  ?@^ @#4 $ \`$ H$ X$ <@ $ D@v $ D? & & P@ *  ?`㿈#\`\`\  @]`D㿐@``?* <c6@:`㿐 `D  @``㿐  ֐ @Rx<0)'%  @Rk@Rf <@R^ 㿐. ਓ.`.2 2`ಕ2㿐.  .`. +` 2 2`࢕2㿐 <@" @ @ .` .2`$2  .2`2  l@ <&㿐| ,"* `"  3 ` "  ``2` 2 2 !#`@@|`0C@@ ,!||"b* `"  3`` "2```2` 2 @qb @qb @q""@q ;/#  c=  # @&& @@" 㿐 ,`"X ` 9 )|+-%' "쀢@2+   a@80?  " $` @ "@ ې@Qx H@Qs H?& H  2 ` `2` ,` ?` " `  @ "@  2 ` `2` 㿐 T R@ "|@pҐ |  b쀢 E*`  @`@`,` ?#@ "@` `2@x *`,` %@#@ ` $ &`, @Q b<`D?&`D ` `2@@q%`@q"`@@ ~&@ ,| ( "  2 2  2 2  㿐#`@] , ? 2㿐 ,` '@%@`` $` & , @P< D?& D ` `2@㿐@Z! (@| $/ @#7 @@  %@ @ @%@&`(9 @| @l ` 2"$@|\ @$`  @@ &@ @ @&$  "@Z@Z    @Z@Z ɔ (  @[-@[)@[㿐   1*! @  @ﴒ  & @F! @ "@ ` @&  @F!0@   & @F!0 !@Ea(pppppp㿐 @y 2@Fw"8  && \  V*# @ ,@^@. ,   E"@ ,   *@     9* ,@K@  ,@K@ @*" ,@K@  ,@ "@ , @@ 2,`@F%",`@$ $ @F"@  "@& 44P㿐 I @`` B*`!4 @ 9$ , 4,@Kp 0$ @f  @E"(@Kd#$"H@DbX0T $  @O 2,`@EȐ",`@F$ $ @E" @ $,,DPdt̝㿈  "@E|b@+@j!h @ +  +* '*@ -'@/12 '* 357'@*  )'@+  '@*  @'@+@ '@( '@( @,@'@, '@+  '@* 7` '@, '@,  '@+  @'@ w (@'@ { $@'@ } "@'@  @'@  @'@   @'@ "`D D@ !#b@ Db@`D`H H@ !#c @ Hc8@`H@m @k '`@k '` 8  @J\ @k 2 㿐@i`(,>7/#c 21 @z  @ @@$@ @ @$@  @y @j!  2    "$ 2 @zI  @zE  &,O<#  2D $`<3=#c``$`@  $@`|b䀢  &@m, |2` ,  R @)* 2 @m@3* 2 @m 6 @m``2` 2`@l& (&  &  2 * *@ &*  &*  &,$ 2$㿐, 2 c@#00@)@*В     @*$(@   @*!?# @*$@  $@c@#@* @xi㿐 8  @I8 @G 2 㿐 @x 㿐@x   *  @$*@  $    @x @i  2 㿐 @},` " ` "@"`@&㿐 , 2  @)D @)s  0cp@A#@w㿐   ,    " " 2 (#@c0 #@cp0#@c@w& (& (㿐 @kĦ ` :/-#+,|` 2 b , R`#@. *   2`@* 2 2@ݨ  @%8@֐@ @ϒ`X`* 2`@ Φ㿈'. `(6 `@y "d`, b;7 V / 2 K '"$ %@ې @L`H @L `H?&`H|""2=@c &@7# @$`, =-+|cc@wb@g@ &@ @& 2 2 2 O`쀢  @*/ * 3 *@ `* @k&@:` @k`@ ؒ 㿈{#`. |2 䀦   ‘"@I쀢  쀢`2  m㿈|. b6 !{ #  2@I`$##‰ "@I[쀢  쀢 2 ,`  {#2`@Ig∁㿈|. b6 { !{'%#` 2@HҒ`$# #‘b@I$  쀢`2 `@sZ`,`6 6 #@H٘㿐. %|2 *  ` ?@{p  @"`@s0 㿈. |6 b䀦!{ #  2@H|`$##‰ "@Hϔ쀢 쀢 2  @ ?㿈. |6 b䀦!{ #  2@HM`$##‘"@H쀢  쀢 2 @ 㿐.  @I4  "`D@{`D @@ %|`,. `%|@ "` `  ` `2@  ?#@``@w@h4  @ "㿐|. "6 ` `  "`@zŰ |* 2 ` |* 2 ` @  D" ,  ," "  2 * *`2 2`  |("   "  R2   6  *㿐 2@G`{"c㿐 #  f@Ғ s@! @z@@r`@n` ; 2! f@@ s@V` f@@ s@G@C` # @D ? @4`  9* :  " \ \@u @q N *? 6*3 $ `F3/-#)@ 2:``26`@@` # @ ? @   "* :  " \ \@/ @+ N *? 6*@ $@``2@!H@Đ2Y㿐 @軐#')+-|/V3!x@~ @% @%  @aX*h & @E,@ @ "c* :  " \ \@ْ @Ւ L@  @c*? 6*h@v!p@s  @iaa@daa@a@^0 , @Ԓb@EV,@ @ "c* :  " \ \@ @ L@  @c*? 6*@箒aH@8@ ,   2@aP@$u @磐㾐  "H "H         /////////@/# 0#0`D!  n@R"X@ ` /@" "@b }@Q 4s@M @ߒ??@=bb@=0_+@Βb 2 `b@=#%`@ `@=c@@O `@=c &,c @[ @V c@O` @K@ @Ec@=,@瑐 ,`@, @=`c@ڒ`0@=X`0@=T`8@ߐ㿐#㿐&&  70&"   * &*  @ &#|@  b* ` 2 @C` @   * @ &㿐``2` `.2 ` 2`` ``2` 9` @s< @ @ @&`& (@ " & @s$  @ @&& ( ",  ",  @r2 @rג㿈  /@ 2 @ _ 2  *@ & S??+'#)@ |  "*`  R ` @Cr @  $     ,@@V B =      2㿈`( `c@#%`,쀢` '?#@ "@` `2@`(Ԓ `,??`"  #@ "@``2@ 2@"`(*@ @b6" @| "@@w$ؖ"` `(? @u`@s؀`@n0@"ѐ@gZ@v @s|* & &@k 㿐 @  `* "T   `*  T2" T &`  @w $   `*@ T   +`"@`` "`T&`0  `* "T㿐. |6 b䀢|"쀢 |@ "怢 | * @  ` @B= 㿐` . @H2 * 2  . @O2 * 2 2. 4 @5@B,`* 4`2 @ ? @<`㿈'D ,'P '"  2" D ,<3# ` "c@ "@``2@ 2`"b86#7   8@D ("8 54D? `,$753`?1``? @  @$Òk` @ $@ $``2`$D`(  @ 3#  23 P @ * |2 䀢   * |2 쀢 "   *  @̑2   P $@ %@@$  2"8a@eD`, D"  2" D, <3#  ` &#@ "@``2@ 2㿐@q@d@| "怤@D*  @2@ @^  ,  "5  2@{ 怣6*  + `"  ," + `  3``  ``2` 2   2 ߑ+   㿐  (@H ,` <#@ "`"@` `2@ *@&@2   `*%| $@   @  @$=  "@ @*@$@㿐@N`@N](`<#@O@O ` 2    0@   `@2` 2[(@ 2`@ ;2` "    @``$  $@8x @8u @$ @ $@8l $ `"  * &2  "` *   @M @M  2 `" (* &2(  㿐@M!h@h @ @ @P@b`@a.`@c` +  *  @"` @sܰ 0D `& @sԐ @7`,`" @<#@ "`"@` `2@@ |*  "$@@ 2`(@9ڐ!`(`(@\@N@7`,` <#@ "`"@` `2@@ *@$@㿐@M`@M](`N #@N@N  ">(? @ @ @28 @n@n20   & * &2``" `*  " @M#`@M ``2` " (* &2(  㿐 @  @ D`D@2x  H`H@!| @p."怢  "@p(` e @ r ` @  @`L @b0@`G`@b+ *` @O @r`?@r2C  `=@L! |"@  2 ,@9 ! ,`" <#@ "`"@` `2@ * &`(: (@z@Mې ,` <#@ "`"@` `2@ *@&㿐@2 "T   GA@G `*  2$@!|'%| "*`  R !2Ḁ`  @"䀢2    `"䀢2   "  @8l  |@ *@ $@2! a@8Z 㿐@@< @8  ,` <#@  "@` `2@? # , @ @ $#<~   c & 2     *@$㿐,` <#@  "@` `2@@K!N,"7(53/<+  `@K{  ` "`@K` 2`  @ &`2` ( @LP2 @Lݐ 2(  :*"@pg( $."(   @K8 Ȱ< #` "`@Km` 2`  @ $`2` ( `@L @L@L@mE`h$,* @ $ *@$㿐?` # 4@C )|V`'U @` @@.  $@7v"5  *` .`!+ ?+` : `:`*0 >`@ <@| 4 @` * ` 2c4@㿐V  @`@ V@V@ 2&`` @  @n`  A @`*  *`",& *&  ` @ $ @`* 4@`@`  *`"& & @&@ @_㿐V  0`V@ `    6@   @ "8   `2  6. @ `* `"%   &@ V@  Dz @_@_\ @_@_R㿈|'|'Db    7!  !|@| $ 4,`@[ @$    *  *2 2`@ 3@0 @_ @m D .`,E2`=.1|2 c ;9|* b: ,  R @  7 b "8@6,@y  @|"䀤 .2 ,  2  R 22 `Ρ. 2 2  @kؒ D " @ "H@5b8@k4 %   |,``2 R ``3` 2 *`2  D2`p 2@K  *@ |' (b7'@L8' 3@LT܀` @+`ؒ* $@LB`    2@ *  @*`  Z  @ E 8% *"@2 "Z   "G7CԔ@L `    2@j *  @*`  Z  @  %  ?$* @K$ 2 `* $ $  @K`2"b@4D `?$`e3<#c@L Ѐ` @ "@` "Ѐ @KO㿐 W  ,<3# "` "@  "@``2@ 2 @  $ # 2% ,` <#@ "`"@` `2@ * $2 b @4!0 *@*@  $ *@$㿐`@]k2 @#. )| ,`@",   R`2`@6 * "@* 2 "`@& @6 @k7@^6 6 @j``,@k.. @^2``, Y   `O -2 ` `$#|!@`|* @ S    @ S @ ,`6  2` `  % `H?&`H@@ ې @=  @=  `2`$  2 -|2 䀢 @ &@Ԓ @^@*@* &@㿈| `D @i` ` @3"Ѐ   |` 怢 #        @  .     `    * m2R@^   *`@a2` ?.#   .`2`PI .  @4,|0b怢2/ (2  )  <`  @` @  ` + ` 3   `  0 3o 0 3 c<c  2@& 㿐. .`6 6`|h!@`c|* @ V  [ @  @ V  + ,  2 2  `2D | V @h $` @i V `  `` @3"`  `, < 6`# + @ @  2 2  &  @h 6`@2"6` @l` $`  㿐|"` @"< 2@2֐" . ` %|`$` ,  2 , 6 i2 , $@  ` 6 䀦.    N*`$@ 㿈 ' ' @Y'@[!|`"@ih 2 `2, ,`1/ `  5  `   4 ` , @XF &`  2 `2 `  7@ $@` `2`/ * |2`@&& 7 `2*@& * *@ &7 @h`|a@ |@[ ,   @ R 7@Zʤ   %,` 2 @b,   R`@* 2 ,@* 2  ,*`2   ,- @  @h@[u7 { @ɦ @Z ),,`4,` 2 @b,   R`@4* ,@* 2  ,*`2   ,.@ 7 @7 * @[82`7  @@ZV ),, 4,` 2 @b,   R`@p4* ,@z* 2  ,*`2   ,.@  @g7 * @Z2` 6` ,@@I@V, @Z4 ,`@Z4`@Z&` 耢 @k㿈  ' @XO'@Z1 . @ZÓ2`E@X֐| b䀢 *   `?@Z 2 `2, ,''2 ,d7#Q /#*` F@Z `  @6 @Z> @ 5 ,` @`@V @Z. @ ,`# $`2`"`H?&H@ ې@:*@:% & 22    $ 2"<   "@jo$ @ ,* 2 |䀢&@&|* @  @jNP&P쀥2*@& * *@ &쀢 @j7㿐|. V@b 6  @ `?S  4 @Y ``$,,` 2 "` , R`@!6 * ,@+* 2 `* 2`@ ,`2    @Y㿐@fà@Y&@XƐ`3|!@`-|. "2  R` #@b ` `  "` + @*  R`@א E2, (,  2`@f `@f  `|"䀦 %e  `6`  60`` 6  `606\\@XT@^@~㿐  @7*`:   `  .H @(*@, :  % *`:    @@ @,.:  `  @ݑ, .6.. .@ ,:     #8cH@/ 0?.`#6`@ | +"'| @d PO @x䀢@*` 2 @Xf @Wǐ c@c`0u- H6`#\   2H@  H ",  N %2N  2   c@ϒc c@ɒc  cc@`2@c @c 6c@cc@cЀc@c0c@c@hz0N %N  2 #@c㿐@q : 2&@&@|&&N u%#')L %% :L  b ?` 0^ *J 2 V ` @Z@@W,`@R@ x@N'2B "L ,&@L  ?&L J % J **:  :",J  %J ! %J  ? 0"  *J 2  J  0 L  %&&@㿈|  ` @@r #@# Pa]La耢`@А 0@@  La@Ւ`0 %J 2c@Ò`㿐`f  2     "   * '  2  8=?7#c-|    &*`2   & @&` *`2 &2'`ޒ2$  Ӧ$` & "  * '  2 @ * *@ &㿐@  @ @,`  @  ` `2@  Z@|( "@5 9 ,  #(?"  2  aX20@-  &  2 2 ?@2 4  1/`?2`#@" "   " 2 ` |@a@b @*@&@ @ &@  " 9 @" ` " @aȔ`2%  ,, h/`2  ^  ,`"V ` " `  "$   2 ` `2`D ` ?`?#/`` 2 ` "  ``2`  `|@ay@a7c '/ @  @ @ ' @2    2@ab| @*@&  ,@aD&,&D j`" ` *@&`@2D*@&D D  H& DH@ & H,``  ,` ` 2` "` ,& ,@+ @  0*@& @c@v*@ &* *@ &@b@b@bVV @6 @]t@㿐@b{@T@bv@T|"怢@ - *@ 2("    `@S@S @@ @ev0@S @@el0"  *` @ @S֐ @@eX㿐 C   +| , @b @Ti`&b怢 *``  "  &  # @a  , @ ` @b &   ,    @< , @e㿐`|倐|  @b 怢 \@T   ,`T``"M` %|)|` *@R` $>`` b怢@*"䀢@ @``@P @ @TH "`* 2`` b怢@2`"䀢 `@_@Pd @ @T'``` `2`@S 㿈 @QڐV  @Ss@b @T@S@QĐ@S|@T9@S\` @,`+| *`b4 @`.`  @Sڲ`@ .`@k* b2  W@s* b2  6 @k`.`   b怢 "@@S @b@S `@ ,  @@S @ ֓.`<@7` .`@`@.4* 2 @@S}@ & #@`* b2   @6@4`.` *  2`@i`@S[@ @h,`@cא@cՐ@cӐ@R㿈?@`!|@`"怢 "`  @R. #\   @c   #\     *`2 @`q@`怢  &  @)`@E 㿐`2@ , H3`"  #@ "@``2@ 2 ,*3" 2`   ` @  2#`"`""` "" 2 2   ,(3  2`  ` @ "2#`" ""  @"" 2 2  (` 2 H ` 2"`0㿐2`< `**` &@ &@   (%'| 䀢@2     "$ @`  "$ ` ""`  2"`  2 $@ ""@㿐`#@@2 @ `,` <#@ "@` `2@@ *@`, $@|<b*  " 0 2 @  "@2 2 @ @$@@$@`, "`("  2" `(<c  "`,  7 #2  "s   |" "@2 2^ 3` @   `* @2$%|` 䀢@ `2  2#`@ޒ`   *2 @2  2 `*@]+2  " & ``2` )'% @1z`H @1u`H?$`H  $ $ 22@﹒ @ * @ $@㿐 @%  "` `"$ `|@1`$ `@'!`$$% `$$`@&-0-`   @"  2ې !|@\@* $`*@   @%$@$ @%$㿐`+|1|/975 + `    , `   @\l #X" D "'#X" , "D2`` " , ` 2 @`2 H" Hې @0 @0~ H" Hې @0 @02@` 5  @2   @%3`@%  ` 5 "@@2  -$`@   @"`    @"`( @$ @$ $ ``ݖ5  $"  "5  ` @"5 ( @$ђ@$$5  " 2C㿐|@:Y0@   w`* p$@   2 hd "#X"D` *1@ @$@    2D`*$@@ >$@  @ $@3ܒ D2"#X "#X%|'| * @  e& "@& "@  2 #X@  $`  $@   2 㿐  *{$"b ,%|+|`#|'| )|<#@  "@` `2@ *  ,* $" 2"@9f! $%U8@.   %`$@$`$   @ % `2  (  `$ (@%ې!P (" @:0 2 ` <# @@$@"  2 @[]c  * $ ,@  @?$ @<$ @:% $@/B`$%`$㿐`"" F  a@%!`!#a@~@~~a` Ӑ  H`  @ (& "@#C@N$ @K @K@_=4@K @#R >&㿐<  #  2 2 `"  ` "# `"` $` #`  ` `2@``# #`$` 2` 2  `& $` $`*@"`&"  2" `  "  * @`@" @# *`&@   2  2㿐 \ S.`<2 c2I     ;"    "` "   ` 2" " "" $ " "" $`$`` `2$` `$ $ "$  & @" &@#` $ 2 2+2'$ 2$$  @ `"` `* `@"`@"}`*`& ``2`` `2@$ 2 㿐 ,  `# )@#@ @#( $   @# $ $`` ` "<@  "`  * @`@" @"! *`&@   2 ` `2@0@  "`  * @`@" @" *`&@   2 ` `2@㿐@ & `D @ *@2%@`D@"w/|`,"@3`"  #@ "@``2@ 2@@2`,낒 `,",@3" 2`   ` @  2#`"`""` "" 2 2@@2`,M `, `Œ @! ` @v %@#t! @ 3`,` 3<#@ "@` `2@@ *@K%@` ` *@ "@* @!4`P 2``$ #   "  * @`@" @!( *`$@   2  2   "``,"*`(3  2`  ` @ "2#`" ""  @"" 2 2`( ``, %`( "   `"2 2 c@Xe%`,`( ``" @!y "`,@@%`,  "  2"   @ # | | " (*`@(P2 "  ` `@ *` 㿐 !|@ϐ @YZ"怢   @Kn@K'Đ @   , "    !@"Bb0@KI "*` 2 @ 8,` `-`|,`  @ R  !3,@b,   R`$@* 2 "  @* 2 2 2& @̑,`@JĐ`R`084  @ @@  `@ ,`@ 2`@6 "%`$@ې @+I H @+D H?& H 2` `2`@JȢ @  ,`@` *2  2@ @& @Jp@[ڐ0@[ @XP& 㿐@J @J`  |"*`3  5` * / '|`  "  (@"*`  R`@  `  3*: @ * :`@ (@[H @X & 㿐@ 2@ܐ `@*@A$@2@ۧ@@2.  t`H`  @@`($@ "@@I`@G~`@G@[ C@G`@@ >$@@u o㿈2  ` %|!|`` * R `2[ @V3* "2  "`Q ``" @ 2 &@VE &@@ "@& `"9  `@ǐ* .`4 @ґ2 * 2 @/.`@2 * ,4 @Ñ2 * 2 @ ` *` @*`6`&`@U2 @UӒ``2 㿈`'  V  0@rV@E` , "  2" @^ ,3`"  #@ "@``2@ 2 ,  @"   2 ' , ? `77+|#b`` * V``" @U%|* 2    @Us* 2      "`  $``b 2 @@X < @@X& <& @@J * *@ *& 㿐!#|#b@x@xb@` !|@ȁ$`   #|@z$ ` !|@4$` $ @)x@$ $!|  @c@$ 㿈 `^  '| "x@b'|+-/`2   * `2 @,  2   *  2 @䀢@ `@  `2 $`bx@v $` @T$`@@W @T@E Ñ/`㿈\`  /`2 @ *2  $@2#\ @ @ @ ` Z "x@*b0S*`  F&@+ #|*`*2 2`2(| "*` b䀧@|@`@U*  2`&| #*` b䀧@"   @`@U *  2 `'  #\4&'   |@* @ &@㿐@ .7;(9( # ./@%&@/' ;@!@ . #* *&@+&@./&@*(@/@, + +@ &@*@&@&@ V  b@Ǧ @b0| @U쀢 @r , " (#  2#  ( "` , # 2#  " |  4 "怢@2# "2 2@S (`(/$ #" @  " , " ,  ("   2$ @S $ " @  " 2 ( ,` <#@ "@` `2@ @S# @S# $ $ (#\ ` @W@H$`@T$` @S` `  @UW @Wې@Wِ`@O 㿈?@ #'쀢@  ' @ @ 0  ?@v#@v#@0@# (@' @  "@2 ' ?c 2  ,@@v#0 , "  2"  , " ( " ` "`2 2   "  2  (`  ϒ "` "`2& (' > (`    ` 2  `2 " `   ٝ   "` "`2  " $  " `"`%?c  @ 0&@ '  2쀤 @RX  "?' @Q@RG@' @Q`" &`@GY@V @S{* & * ~&㿈?@ #'쀢@  ' @ @ 0  ?@u#@u#@0@# (@' @  "@2 ' ?c 2  ,@@ud#0 , "  2"  , " ( " ` "`2 `2   "  2  (`  ذ %` "`2& ( ( '쀣>    ` 2  `2 " `   }   "` "`2  " $  " "%?c   #$'    ' 쀥`?' '@Q1  #2 ,3`"  #@ "@``2@ 2 ,", ,3" 2`   ` @  2#`"`""` "" 2 2 , & ("  2"  , " "  ` "`2 2  @C ( @    2   2`'  2( ,  ׫`  "` "`2` " $` "`@" ,%3`"  #@ "@``2@ 2 ,",& (#3" c2`   ` @  2#`"`""` "" 2 2& (耤 @O@P4  ' @Oה" $@EF@T @Qh*@ & * &☄c"c!x  "Єc0"c0(    ,  `3 "  *`#  2 2  ,  `<( " 2㿐 , "  2"  (  `"8' 2& ,?`$+`?``? @  @`4``2`$ , &  2&  ,`<3@ `"@ "`# 2` `2@ (" ,  2  , <  2 (" 2,` ,  `<( " 2  @ *("㿐   @-@ ȴ`<*  c  " @-s  2`  @ & 2 ( @.@.㿐  ,`  @  ` `2@ 㿐| "@   * `"2 @ 0  2  @  㿐| "@s   * 22` * ` @ 02 @   *`0 2 2 㿐 ,# (?"  2  20aX@  &  2 2 㿐 ,+`3 " ) 0  ` 2'`& &  & &2 2`?`? "% R2 *` 0  (`?     *`0   & 㿐 .`6`@|"`@ "`@}bx`@N `2, @"x,   2 2㿐@AI @> @?@Rb㿐  %@?`  "c , @ @@ c & c@A$ @>$c  $  , @  @> & cԁ㿈 . #\2 8 㿈. 2 #\, 㿈@@   ,   #\   & 㿈. 2 #\ 㿈@@Π   ,   #\   & 㿈M@N5|@N怢 @@@ |"@A~`` @A7 #\  ǚ @Q" (" ,㿐 @R/@` "@@,`㿐  @+""h  (@ 2`   (  @,   ƀ@+C   (@,}㿐@pr#@po#?@c "  !`@pc#@@p\#?c "  !@pP#@pI#㿐! #`h@pQ@pM`㿐! #`h@pC@p?`㿐b8 "b8 &$?`$)`?``? @ ޒں`4``2`$㿐b8 "b8 42? `,$/-3`?+``? @ ےڃ` @ $@ $``2`$㿐  =3#  21 `@o * |2 䀢   * |2 쀢    *  @w2   & ' 0 2㿐@2   `*%| $@   @    "@ @*@$@ @ 㿐2`*@    * 2&#|  b䀢@  2  2#     *2 @2  2  *@K32  " &   2 ""   `@ "` 㿀'D% 'L  'P 'X'H'@)j'@)f '@)b 8@)^ H@)Z `@nϴD (@_D@  @<2`  @ D* @$@@x"`D@ 9@>4@2  @Ð`x @*'\l#L @<2   ` *`  $@2`? @ * @$@@) 2@D|@2  "c@`xP |, , @h2 |, @q2 |", ` 2  `2 ` R `$  d  ,@m h  , @Q, `@p2   , |2 䀢 |"쀢  4 @74 @W`   @2 H 6$ @(ǒ@(Đ@(@(@(<@2c` `*` @z$@2 '-&c@<2 `*` @)K$@@)H@)E@)B@)?,  2@ * D@)"@)@)@)@)@N@s H\@ђ X"㿐'P'H  'L @(#\@( @( 8 (  < 2`   @ * @$ |' 31@` @`H2 2` |@`x|#`P@ P @M `BH 6@|2  "c@n`x|`b䀢|"쀢  ` $`@] `@} `@2 L 6`@'@'`@'`2`  @  * @$$2  `*` @($@(@( 2 * @)'@)@) H@ 㿈'P'T  'H  @'o\@'k @'g 8(@lۨ'  < 2`   @ * @$ l& 1/|@` @`2` @ؐ x 2H@ѐ H @ `6%|2  %@ x|`b䀢|"쀢  @ؒ `@2 P 6`@'M@'J`@'G`2`  @  * @$ $2  `*` @'$@'ܐ@'ِ 2 * @(b&@(`@(^@MJ H @sT @l]``@lV`0@l 㿈'P%'T ''H!@&#     @hc'2  (2  ,  $`$$@g$"@gJ@ ր    " $ 3/|-@"`   @`x 2H@ H @b @`'`48؟@'8@ ?E"ېb€1|@gO  %@`x|8* *`2  48|"쀢  @ P H@&nH` @&h@&c@&_ `#$   &# ? $   @h@&@&@& 2r@'@g H@ T@k` @kx`0@kŐ 㿐 6  T`2 `"a@ @E  (@  ( H *`  *  D*`*`@   "a@ @'` `)ʐ %  "  *      * @@ L" H D*  *  D@**`  㿈`#}z'tH쀢*`" *  * ᨉB!` !`Ȁ !`Ѕɢ"?@j@jے` D!   H   @jǐ@2 0 .ܱ   2 (@ja8@jaH?@jaX ( ap  @j@@ja0 @@@ja0@ja㿐  @L@!| c@""`@/-+#|%)'؟@8``(!Ȕ @(`(*  P@{ @V@@e @ `H  @ .`(@ ,`( @  H `(@7 㿐@fI'#2  %ۑ2  ,!` `  ( P$##$$`$@eK@ey`@+)-|1'ۤ c؟@ 8 H ∟€`?@eZ` `@@ "``c"#@aX@ |" (b@ @f 㿐 @u#2`@ ` "@ɐ!2 @!@@!@2`@ @ ]!|@!`#@G"@   #!@ݖ#%   @ @2`@V `  @ ,@ .@O  2 @{㿐@ ǐV@` ,J+|/-@2@ @2`@$ `@[c @"   cȒ@#)   @h @C!2`@ `  @ ,@ .@  2 @* 2㿀 T , ` ''@ " " "` `2@@@!@ D耢 @"@@"@"@ H@ H 2@% D@% D  ,@&A@&=` "` 'X  D@&R @&L  D @%@%@T@"(@@@@I+ @"8|@"H|`@Ngx  @ @`@ e   &@@w"X|`@N?x  @ @`@g =0㿐'P@h,    (` ޴ UU!V`   3# &    JG %|@V:  zZ@" `?  `,  @`% `- @x@y* ` 2 ``  R `$ ` @f     |- | b  `@  "R` .`` @ - |2 䀢 |"쀢 "*  ``P "  4 @4  @۬c ` G@@?'@ <' ;@Z@: " *@ /;O@ (Oc@: bgZ @:" *@ cc@ : Z @" *@ *` c` 2)`@H@@@ @а 0 㿐  c N#@͐J"H`+-  <  @x( @x4 * |2 䀢 |"쀢  #@ 6 @$@  @p  $ c@g#$,@ @  &`  @@ 2? @@2 ,@#@ ƒc,@#㿐 (` \`d#@fՒc(0@ـ@f  @ @  ( `4 H` ( # @ @rZ@"" @M `#ېP  cĀ@<  `  24!@4`{ (, "Ā ò0g H` ( # @ @rZ@"" @ `J#ې  cĀ@  `  24;!@`0 ( "Ā ò0U@Ӡ `#ې֘  cĀ@   `  24 !@` H@ 02#bx@f@eb@eb0$@ `#ې  cĀ@  `  24!@` H@ 㿐|`,  !| 8@P*  $`,@ ɐ#@ 8|* ?$ 8"`4`,?|""0㿐||!|0 4@  ,  ||`8 @** $ ,8 @*`$ , , 2`8@ #@`8* ?$`8$40? ,* "  $0* "㿈 \` #\#`  0?@#@,@"`%|!|* @ "쀢 #\#`ʚ2 @ 20|@2`u+|)| = * @  *`  6b, *`b@ @"쀢@  #\#`@  `#\#` @  Ց,2* b@ "쀤 @  `#\#`\Z   (#\N#`2 @ 2㿐`<`| @* |"`@`| @ |# #@ c0.   @{ 2& @ @ @ `( `4   { 2 @ `?   Œ!@E㿐|!@JE   #@d`c01@x=| "|##c@ + 0Ő@ |  | 0  `,  * @" ,㿐 4  '8,    @M&8`$@! @ (@@ 4  8     * @`0@@h )@@ 8 @  #@ H  !@ܐ@! @   @D , @  2@Β 㿀  'H#@c`P0 (! #@-3;@c @c`< 1cH l @c`@d- @ ` ` -@@d`   2-@2-@ . -@@a   @,@ےa @֒a   @cC`@c@`J# @%`< #@@?2`? @ * @&,*@c!&#     ?2  * @&@ @b!0kHi <?#@\@Z?2`? @ * @&@x'X!|'D  'H'T'@O'L@K '@G 8'@C H'@? `@b'"  ("@X"@]'\2@쀢  +`2`@+`D! @ ﱒ < 2`  @ D* @$l"51@KG 쀣@" !|+`" *ؖ@`\X@ "@\@82@ "`@+`'L <2   ` *`  $2`? @ * @$@ 2D *  * * 2`@s- |* 2` 2 @s"|* 2 ` `` @s&|* 2 ` ``Id F`` -`@` <@r4`|* 2 ` `  @r !| @r4`|* 2 ` ` w @r -  6@!| < <@aْ!P < $ <` ^ |4`b䀢U|"쀢 Q !|? <@r@r< |*"  R` $-  ,6@@r -  6@!| <2 <@a!P < $ <@r-6@!| < <@a|!P < $ <   @2 H 6"@@@@@ <2`  @ * @ $ <2 `*` @$@@@@ܡ, ` 2@2D * ؐD@"@@@@@AT"㿐`@a 㿐 ,   6 㿐@ZV@|` ,   ! 㿐@"h@6@| "p@}#  @B@@0`  0@!V@|w` ,    㿐`2#@"h@ H@|  H"p@|  H @@@i H0`  s H0@V@|9` ,    H 㿐@ @ @ `( `4   U 2 @ `? "`( `   #c@`A @* `?㿐Ő@㿈]@`( `" `(` 2`(@{ `(#` #\ |#@` c`| ,㿐|!@Eې   #@_c0. |  | 0  `,  * @" ,|0㿐b @-+)'%ۢ ؟@`8 H €`?@[%`  @"` ؁@"  @㿐 ( @{ 쇐? @%`+) -@@@  ` ` 2 "` @ %  @   2 `2@@d%`` @  D$ !@Sa0 $ !@Jaȁ* *`2 2` | |䀢@@|怢@ |쀢@ ? ?㿈  `!@-a@  2  , H  "@b80~>`"7 ` 2  "H,'?腠DB'@ԓ-  W,$@   @V ,"`,@"`@$ 2@X (" * $& @ǐ!@"@ǐ"8@ >" @ǐ"|@" @ ǐ"@!& > & "@b80a&㿐@`@8F㿐@ @oo`* , 4`@oj4 * (2`㿐@ @on`* , 4`@oi4 * 2`㿐@ @oM`, @oI4 ,`* 4`2 @ |  "쀤@@ @  ?㿐@ @o=`, @o94 ,`* 4`2 @ |  "쀤@@ @  ?㿐 (!@+) @ <c&   & " @  @ @&  ``& @@R 2 @ *@$㿐  @]ߒbP@ @]֒h @]Вh@]̒bp@ f@^ s@^!h@]@]" ; 92#@]b@ f@] s@]h@]@]b f@]@]ސ s@]@]b # @f ? @]wb  "* :  " \2N \@]N@] N *? 6*3c $ `D3/-#)@29``25`@]@` # @fA ? @]3"  "* :  " \2N \@]tN@]q N *? 6*@ $@``2@@] 2T㿐 @#')+-|/3V!x7@Bː Nd @\c )0 % @ ,@ @ "c* :  " \2L@ \@]L@@] L@  @c*? 6*0@\#8@\) % @ ,@ @ "c* :  " \2L@ \@\L@@\ L@  @c*? 6*@\cP@\(@\/ + @`X@ ~,@ @ "c* :  " \2L@ \@\L@@\ L@  @c*? 6*@ג`x`@x  ,  c 2@\A螒 @̐h  "     /////@/# #0w`D!  n@O @ `j x/@$  @ `Ц W@ 4MͤȒ@~@??@`a@0:)@a0 2  a8@ה#% @  @ɒa@  @a &@,,@ߐ @c@1a0@b0@b(@6㿐#㿐!| @  "X@rb  2@ P $ @@"㿐  2@ B㿐!| @ "$ @@ $ @㿐  ` ƀ@ "``|@ `@ `@^"` 6$`$`&@&` &`&`㿐  ` @ "``@  `@8"` 6$`$`&@&` &`&`㿐!| D  "@b '@ ؔ $ D@#㿐 '@ ʔ㿐!| D "$ D@ $ D    㿐|@ ?`D"" 㿐@ 8"" 㿐 "   |@ )`D"" 㿐 "   @ "" 㿐 '|@@ D"" $``" 㿐  @@ "" $``" 㿐| @ D㿐@  㿐  1| D@   㿐 @   㿐|@ D㿐@ Ӓ㿐#|`H  #(@1cH@P  $`H#X@%c||" P"`L 㿐!| H "|@||$ H" L"`P㿐|| L`P6 |*`H# L  #@c "" " " "` " "`"  ` "  ` 㿐'L 'P'T 'X!L#@*@㿐!'L#'P'T`H@c'XL@@[`h@G 'L 'P'T'X `@C` 2z`2 ђ``L@|`\   @5@2 @- |d J \`Ȁ %"d@$ & \| X`     \ c@Y#@Yq#@ZA@? \"*@a & \| X`     \ c@Yc#@YN#@Z@ː? \@!| \$ `@  `@ܒ`+ `@Œ` 2!| \ "  @|$ \" ` @`耢 | `@` | \ 8`㿐| X`  @ 0 c@Y#@X#@Y@x?㿐#c@X㿐| X `   0 c@X#@XԐ#@Y@Q?㿐`(@Xِ#@F  |  T㿐 | X``0  @ 0 c@X#@X#@Yw@$?㿐#@Xa | "`T㿐c@X#@X#@YX@? 2 + `  @ " 2 "  "  ?` 2  2  `? @ ?B    @"5 2 @"@  2 @2 ֐ 1  @"-?+" @'" %  @   `  ? ? ` 2 ` 2 ` `? @ ?㿐|#|`  @` *#N@  $`@*`$ @ߓ*`$   !P ` *@` `N   *` N` *@*`  ( 0 (Α*  F E D C B A 9 8 7  6  5  4 3 2 1 0*@`(8ϔ9\9T9L9D9<949,9$999 98888㿐`2     ` `  @ `@`2 t!h  2{ \2 o7^ϕ*  @ " ? , , s, " 0 , , j, " \ v,  , , ^, " \ b,  , , R, " \ r,  , , F, " \ t,  , , :, " \ n,  , , ., "  , , %,@   \ ,  x, , " x,  , u, ,          q 2 \,;;p;:;;@;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;:;;;;;;;;;;;;;;:㿈 " '?@!B@'@  2!  "g^ @>  : " * @*`& `0* +  ?@ * +  ` ?*@ *㿐 `* 2 *ϕ*# @ F E D C B A 9 8 7  6  5  4 3 2 1 0@Vz !a *`:  Ƞ ?H?@?8?0?(? ????>>>>>>Н㿐@ 0`?  ֐ 1  `` 2  2     @Ua @Uݒb`   @UӒby@v`㿐E@ A``%"`@ 8`?`,Е*`" @ @Ub0) @Ub 0# @Ub(0 @Ub00 @Ub80 @Ub@0  bH@U 0yAXAAA@AApAAAAAAAAAAAAAAAAAAA㿐 @ L ` " " "'4* 5. \ ,( @U=bP0* @U7bX0$ @U1b`0 @U,bh0 @U'bp0 @U!bx0 @Ub0 a@U 0 㿐` ( ` %@ *` 0  ? %@ @b bb@T 0@ ` u`@`` 㿐  .2 3, ѕ*! @ F E D C B A 9 8  7  6  5 4 3 2 1@ ` 0: ` 0@`2  *`:   EEpEhE`EXEPEHE@E8E0E(E EEEE㿐`  `%" @Y "J ?*ҕ*!8 @@Đ"00@"80@"@0@"(0@"0@" 0@"0@ "`N @@{ \@x u[ X@o "0o $    ֐ 1  `` 2  2     4*7@G \@D u'3  3    " ֐ 1  `` 2  2      *@: 0@ \@ x 0 @  \@ u FFFFFFG G G G G G G G G G G G G G G G G G F @  `   ? `* @*` `2 ` @2 `**㿐    ` `  @ `@*   * *  2  2 **    *  * ` * @*` `2 ` @2 `**   2  2 㿐@ @*  2N!@N*` *@N` *`*@㿐`2     ` `  @ `@j`2 !h *@  ` 2  2 *@ ( 㿐 @Ò  2 `! ` @,, 㿐 @  2> !x> , ,㿐@` @Ra0` @Raȁ㿐@  ` a@R  a@R @ ` 㿐@  `@`` ? ` ք1 @  2` 2`    㿐 N @0 @ \@ ub _㿐  L @m@h \@e u H E   2 㿐    㿐 @  @ & @ &     2& ߐ"& 㿐 @l@^ @\㿐  r  Z@ " ,`  "&6@  ?2$  ,`"@ " ""㿐 r  Z@ " *      &6 &?㿐ƀ  r  Z@ " *   " $ "@@Ȱ 0?㿐@p *@ *`  㿐  r  Z@ " ,`  "6@x  ?2 $  ,`"@ @&&" ""㿐   *@  @   2& 㿈|   t  @k$&`4``  @Ò? @PҒbఀ`2``",`4@L-  "@ @ @ ?@ ? `(#: #\@P`4`Ҁ` @?  E =@|? = @v`  @o? #@Pz: 㿐   2/&  @p  2 n# "  ,@e ( $!#c@PZ@PVc@ C@: [@ @PH`@ & & & 0㿐@  !##@cP @/ 8 -#P@$ (  @!$ , ($ @$   "@$  #`cP|$ $$ 0 "` $ 4" 㿐   ,` $ ``2` @2``2  0<#cð 02  , 8 (X  $`2 2`  ( 0X#  $  㿐 2  $    0`P 0 2 0 ,@2 %  0 (  $ 0$ $ $&㿐`(   e``$&&`$㿐`(   W``$ 2#``@Ok`$&&`$㿐 !|  4` 2  4"4" ` `@@ؐ`2@Ӑ㿐|`  `` 4`@@`2@%   " " " $" 0㿐 $  ,  (  0     ` @`@  @㿐   &@ &@ @&㿈 -@^  "Ӑ ϐ @`?&@@ ? (": #\@N㿐|)| @ 2|`@@&, ,`  ,`@@#ഐ$% `2*`ഓ2`2 㿐 !@  {@-`  t & && (&  -?!@ `@ߑ.`  Y @,*``@4 $ $`$@$`㿐`@=`` ,4,@,  /!@6)&`  -?!Q@ @,   `@,`*``@6$  $@$ % &` &@㿐`@`:` z@ Z "@  $` `, 4, @ʓ,   !@6 $@<#*``@4$@$``- 2 $``:` z@ Z @""@D`$`@{ ,@!@4 @-,   . @ ,`<#*``@4%%%($     2+ ` ( @ 2@ ``/  @ 2@ `'%$@$    2+ `    2+     2 %&@&`@@̐㿐|`  !| @2 $` 0  |?"``2㿐!| @|$ " | |   㿐@ @ !؀@4 a%@x @q,    @6 $`<#*``@6$`$@$$$`$㿐  @[ @Y@W< @"(`"`0㿐 @"&   "̒b@_!@6 " 6    "ђb@Q!@|@&&"&㿐@   "ݒb@:!@e.` 2     㿐 !@ g@,  ` @6 $ <#*``@6$ $$ 㿐 @ @Ґ㿐`@@  `. @4. @.   2!@6 &`<#*``@4&`&@㿐@`   `, 4, @,   !@6 &@<#*``@4@&@&`. `2  &` ( @| 2㿐` & , 4, @,   א!@6 &<#*``@4@&&.`2 `&㿐     , 4, @,   !@6 &<#*``@4@&&   &   `"``( @2| 2"`㿐``& `@   .`@4.`@P.`  i!@6 &<#*``@4&&    2 & 㿐` @ ` .`@4.`@.`  7!@6 $<#*``@4$$ ,. @2  $ ``* 0*  *  㿐` #  @ @S=  , "   ( @ @22@ @8㿐   !0ܒaH@M  2$  Ɛ!$ $"㿐 @D`@< "@|2* 2  2  ( @"" 㿐   ,`@ "`@  @ `@& @ @㿐  @# /*``` ``+ ,  @R `, a@JL @*`  @  *``@  "  ( @  @22@` @㿐֠  1 `Д%ܕ*!P @           #bX@I `1 Д%ܕ*  @           #@IגbX .  pXp`phpppxppppppppppppppppppppppppppppXp`phpppxpoooooooooooooooooooooooooooooooooooooo㿐  1 & &J  ` 8 9@ ? @?В[@ + $ @!  #b*@IV @IRb*@ 㿐'D `""H #@I?bD`'Db ` \2Z,  x֘1  `D  ` DD `,'DD1J  ` 8 9@  DD ,`2/ .D 'D *ݐ  @ , , , ,  , , ,D , D  'DD  "2 D,  `"'D "H#@Hǒb"Ht\t8thththtPthththththththtthththtDtht tht,㿐'D `""H #@HbD`'D ` \2,  u+֘1  `"&D  `"!D  `"D  `"D^,D Y D `,n'D ? 2k i?D  xD 1 @ D  `D,9 D `,N'DL 1J  ` 8 9@  D,D  `6,4 `,'D `? ޕ* P @ , , , ,  , , ,D , D  'DD  @,`'D D  "2d D, ,  `"'D "H#@Gb"Hwwwwwwwwwwwwww`wwwwwwlwwx`H  %"  *  `H"4*H㿐@<`{@ ?`} d #@Gb d4$! "H@v,"H㿐 @ B+) "' % 2 @ #(@Gb@@H`H 2 N(  `@, 0! 0@GW @ @@GM@U`? `ʀ㿐 #H@A |  "`Ā` c c $  Ā   Ā`  #@G)c0/`2J@`"  J@ -2 J`   1c c  "   (*`*`*`*`*` @cذ  @#0 @ 㿐  !|cH@  $  cR $  Ā     #@Fݒc0 @c  @^#0 @ 㿐  cH@|   "`!`' $  Ā`2J@  @F#07 - J`  !1`( `(  #    (*`*`*`*`*`*` "!@K`0  @K 0#  @ #0  #@F}c㿐  !|cH@m  $ !`8Ք $  Ā "!@`P  @ 0#  @ߐ#0  #@FOc㿐|" N r w!7!N  b   t  *%!*!!9*ߐ&N  b   t  *!* !H! X`h :0&N X`h 0 | $  ̀"` !! @E`x!` @E`0 `@E㿐! #c @Eܐ?@1"@`H@F[ց(@㿐  @cH㿐 .`#P>`@E@F{@Ȑ", <  Y"   n  N 0 y   `y`Y      @E#`,`ѓ:`㿐 @ @ 2 !쎐  @  !셐 "$0@ ' !!#! @`N$0@$0 2 $($,@d$4 $!b |$8`$<"`$$㿐`2`4!! -!`8* "@`4`( `,&`4 &`(&`,`4 2% `0 &`4&`0`8`  @.  @* 2  2 &!!`0!0a( 0`8& `8"`&`8 㿈| ' Ԁ  g  '@$&`<`  ! @? !@DaԀ`&  '`'!`0Z`@g`ت@% ?@Ő ?``,`(: #\@D̐`<`߀  ! @? !@Da!@DaЀ  ! @? !`!c@D:  "  4 024  "4 180"4 "8"084((@"( "  4 0  < 8 8 1*` 8" " 4 8" 82 8" 4" (㿐 & 4 2 8 0  8  2   8  2 4@ ,` @`@,`  2 8㿐  4`2 8 0  8  , @@ ?,    1㿐 8 `#| 8 & 8`  8  & 8@@ 8 2 8`Ԗ `<  2`" < <"`<"@s 0Z ԁ ؝㿐@` !ڐ"@Y 2$`!Ґ"$`$@,$`㿐 @P @N " (㿐`@ @  * `@ 2&@!ꨐ"(&@&``* *&`㿐`@`@@`@  *`@o 2&@!ꈐ"(&@&`N ` *@ N  *@&`㿐 @ 㿐 '`" @= 8 , 4,  @8,  !Q"`& %&* " 0!!"8bP@ 2 !6"P @/ 2&!-"P&$ $$ 㿐!"LI@  @-`   & && !& -!)!`8"Pڔ@  "P @ ,"P,$ $$$ 㿐 !!"8鸒bP@] 2 !֐"P @ϒ 2$ !͐"P$ $$ 㿐 @L @J"  㿐`@`. 4.  @.  !饐"`&`&@*`" 㿐@` . , 4, `@i,  !邐"`&`&@*`" . `"  &` ( @"" 㿐`&, 4, @4,  !M"`&&*" .`" `&㿐  $  , 4,  @ ,  !%"`& &* "   &   `"``( @"" "`㿐` `.`4.`@ȓ.` !"`$$*" @ ,`. @`" @ $㿐 !!"xΒb@?  2$ !踐"$ $"㿐 @6`@6" "@&"* "  㿐`@6`` ,4,@d, !}#@6"&` -!+!8bPK@  jbP @c ,`bbP,`& &`& @%&` &@  ( @""   @  *``@  " 㿐@R @  ?@Rߐ,     ?@RҐ,  @ @   !#( @6,`@R,@R,  ,`,*`㿐@@R @   ?@R,      ?@R,  @ `?"`@ɒ   !ǐ#8 4,@@Rq @   ?@Rf,      ?@RW,  @ `?",2,*,,*`㿐 @  2!炐#`@R1 @  ?@R(,     ?@R,  @ @ !Z#`$@, $!!#p@c`@ &@㿐 @=  2!;#@Q @  ?@Q,     ?@QԐ,  @ e$@*!\ @@Q @  ?@Q,     ?@Q,  @ @Q,`@Q:,`뀢 2$`.$` @Ւ 뀢 ג$$ 2$`!#P$`@ $`-$`!!#抒cPt,㿐 @ 2!朐#@QK @  ?@QB,     ?@Q5,  @ &@Q* @  ?@Q!,     ?@Q,  @  & `` 1*`"( @  @D  & !B# @ @3 "@ ` @) &  !&#  !! #c 0@   `*" @Ɛz`@P @` ? ,`@P,    `,` ?@P,  @  V"@P,`` *@P  H, 뀢 դ`= `8 뀢 Ǥ` ` ,`@)" u뀢 ` i`  ``` ,`" @&r HPPPPPPP㿐@ . .> 57((;> .(@> .9@. > @7> (/@(+> > (* @(*@ > > .* (*> > >(> / > + .@(+@> > 6 >  ߱>  &@㿈^   @Ɛ  |"bl |3bl bf2 K*" @.+ . + .?@..:@ .5@. @`" ``"   `"  .. .!"#`~. "" v`.?@Kbl` 2 @@86@&@|ȝ㿀7o @O$ @  ?@O,     ?@O,  @ @O @,  ' ?@N,    ' ?@N,  @  6 2 @7, ; @ & I&` =#@N̒ @  ?#| ,@N,    #| ? ,@N,  @ * l2`  * 72b䀢2  & 5` -`쀢 2 `Ǥ ' |R`  7'@UL@SH@’  &L"(@  $H"㷐(|3   @Q,;"9"@N[ @ ` ?7,`@NO,     `7 ? ,`@N?,  @  ? `@<  * L ?`@ XM < * L ? 2 ,L<: " L?|l* `  *"2`@17*@,&  '!|bL"*`:lH,`: +   + 3@ * + 3@ `* :`@H@J;  5` 2 -` ?@lx7'@M @  ?@M.    ?@M. @ @M @,  ?'ܒ@M.   ܡ, '܀ ?@M{. @ ܒ 6 2 @7.; @ & P&   =#@M\ @ ` ?!| ,`@MP.   `!| ? ,`@M@. @ * l2`  * 72"䀢| &"怢 2  ' 5`` - 쀢 2 䀤 Ң ' |R`․  97@"T@P@K  '"T"I(@B  &P"@(|3  ` @\,`;"@L @   ?/|9, @Lؐ.    /| ?9 , @Lǐ. @  "<`  * "T ?"`X@Ӕ <` * "T ? 2 怦, ',"T<`: " "T?* |l`  *"2`@17*@,&  7!|"*`"T: lP, : + @  + 3@ * + 3@  * :`@:@I9P 5`` 2 - ܀ 4䀢 |"怢@*7 @N 䀢`|  b* 2 l`   .@* 2  & & @=l㿈| ܀"d`r@ Z @2 ! >#@:@Q "h`@ ` 2 + * ``2 @ *@ * ' '@Kސ ``*  '   *@# U)"d"\@#"d@K@@ ? %@K,    X, @`2$ D" @I )X D*  "?耢`6 $@ $@" h൒`x$2  !-"`N"`%b\@K#-h@" 2 D?bX*  "?$耢 2 @ $@2  ! "`"`U%"\-h 㿐\ @& (2@ + * @KE#@.@ @!$"X" "X""``2 (!" #`@9p"@9k`0|"؀`&$>|"^ @`ȕ:# " 9"'")@9O #@9L в##"`@9D@S  (|?'"`ܪ ) (b`$\b``(  %"dՔ?<b` (``܀  @ cb` H  ""&  a 0+ D ?@6X"X`"`  D?@X.`"  @& , D (& , D "0  "& !a 㿐\@J @  ?@J,     ?@J,  @ @Jx @  ?@Jo,    0 ?@Jc,  @ @) 2  " ߟ!00 @q !" #pa0j 0@& L & (& ,$@J5*bh㿀'耦'쀦e "#ap@8d 0@J @ ?+ ;@J ,    +; ?@I,  @ @I @  ?@I,     ?@Iܐ,  @ @W@Iϐ @  ?@IƐ,     ?@I,  @ @I @  ?@I,     ?@I,  @  "뀤ܒ@bB@@"& D& H!#\bh#`c @ & 2 c"" !ފac"`!ؔ#\bh#` @=bh    3|9"@(7"b䀢@2 $P@  4 b䀢@2`!@ ?$` bh"" !`!aPbh ?@H,  @쀤  ""?$ !b$'耦@w耢?@@@ ,& ,@@@| 䀢"#@7b0€@4 } @= `!"#bx@6"@6b@ B㿈' @= ,` @9`8` ,@`L ` -  "  ?$&`8 @ @z 㿀@=I <쀢 "@Ք??#` c #\ '@ `!"@<c "#@6zc0@=i "#@6oc(0@=q @#㿐@H @  ?@H.    0 ?@H.  @ 㿈'@= 2 )  @@ 8` ,`@`  , " ?&`@& 8 @ 㿀" @c  "#@5c0@<ޒ䖒  ''z  @<'@yߒ @| ؁㿐|!D`" e'|c@$"⾐#H#5%͠a||""aH⮐#P|""aL⢐#`|""aP▐#p|""aT⊐#|""aX~#|""a\r#|""a`f#|""adZ#|""ahN#Ƞ|""alB#ؠ|""ap6#{|""at*#o|#"ax c|#"a| W|#"a 0K|#"a H?|#"a `3|#"a p'|#"a֐ x|#"aʐ |#"aᾐ |#"aᲐ |#"aᦐ |#"aᚐ |#"a᎐ |#"a႐ Ƞ|#"av ؠ|#"aj #"c^ #"bR!|#"aF!|#"a:!|#"a.!s|#"a"!(g||#a^ h|aD X  $ & ( #" |`1|##ܒ  `#` #$"`pȐ |#(" #*"<㺐 #&f"└㳐 "@@X"c   d'?ؐ'''''@'!4"`|#$00!|$!,#|H!8㍐ &!4$aD㿐`` 2@#!@ ** |*@ aB* !@*  +* (, @#@*@ % '* )*  + 5`+@%`(%`(%` +%`$,@%`(,%`,,%`0- %`4 qO5`%@%`8%`<%`@%`%` %`%`%`D%`H%`L%`T%`P㿐|7|  .`䀦@ 2@ HE' H5 (13'@(..'W P``7  @2`('`2@&'`0 +710;#@ @'@'2 2&㿐|."6 |@Y@ * &@* + *  &*V  @ R 6 @2`*@&`, 72 c;# 2)@ &@ @ @ &2b 2#͐! * &* &*@ * &6 H & H`&&`㿐@n  `  ? ` #*  2  &*  * 2 @b  <#*  2  `?#` *@@ *` 2 `&` 㿐@- , E  =?'##c/#-#+#)# @'`@$**``    |"` 6 @2C @: @2< b` *@  *"02  2  2 㿐 ?&@: ### "Hbp0/   ,  &,   @, *`@ * 2  ##"ْbp|.  @ 2 &@# ᰔ$@&@;@@ 㿐 2T+ `##"شb?###"تb|`谒 26#ǐ"6 & &  @*㿐 ` 1|*2 @8  |*"2` ###tc?#@##"hb 蠒  #؆" 4$ X.`@$ 0& ###"Jb 贒 #h"6&:` &  @* `2㿈 `fV  ;`V@ 2` 6` @)`   @ `20z    8 4` `@` d  @* `20Z  @  8`  * `   8  3`    * 4@V@  `  @ `20  `  @* `4@@l& & & 6㿐  `|`貒 26@#ע"6@ `&`tR&` V  ٔ  V@   `  @ `2@` ` *@@*` 2         `@ &+ 2     & `##@0Fc 0& 㿈 2V? <  6 ' @   *`"  * 좒  # #x    * 2+ 4@  & @& & &  6㿈 2VO L `G  ?  #*@+  2` 2 *+    |@䀢   * 4`  #ː#  ? # *@ * 4 & @k4`& & & 6㿈|.`b6`@8?#@4V "  @ &,` @  `## #Hec`,`@ @Z *@ @0& & & `& ,`  2 2㿐 2V: .`.`@ 2`1 2  ,* 2@  %* 2``*`  .`* 2` * `.`2 ``&   2& & 㿐 @ Ɛ* ?2 c  ##"b|d`谒 2#"6 &  & *+|)| ,a@  "  * T`   G ` , @ ; T` &` & 㿐|?"c ##"ըb|`覒 2#Ő"4$$  , 0| "( )|!@  b  * T` 2  6` , @  T` &` !@ 2 |"*` 2 㿐  |`蠒 24#z"4  M$ $ & o "` ,`` " `     2 ` `2`  㿈  ' @w=  T    ( @``, @?4 , @?'4 *, 2  `2?4  " ?@?,* 8 ?2@ , ,2    ?###"֒b|E`谒 2#"6 & &  -  `, @>͑4 * , @>ؑ4 * #|2`b䀢* 2@`24  " @>* b2  *  2 2@yh@㿐  2    2  -%|%$  !$|!@`I  S      @h@f @d & & $ P`pӏ%|@`$  .    `" & & @@@>    6 | b @ * `  @  * ` *` R 26 㿐@| 2$ $9 $  $` *# @. . @|$ $$ ` @|0$ llldlllll㿈/ @|/蠒 2 8$  8  耦$,  , [ 2 @| 2&$ &`&& 8&$`㿐ٽ|!x@|S  2 8$̐  8  $` $ @( ``2@ @| 2&@$Ӳ &@&`& 8&`$㿐 @3 %$)$'$`. @  8!   @|  2 @| 1 @|` " + (j 0&@&` -  " "`@``@{  $``@|>*` $`$W!X@ * `"@`$@㿐| 8  !ө "   2 2$8 $ !h"a0;@{  2 $$    $ސ ! 8  ${   2 @| 2$$ $$ & 8$ $ݐNx    *  @  @ @`@,`  @6 +|)5' %| ,`@ a̔!|$쀢`2`@;W    *`  `? 2`@{4`@&   @. +|)5' %|,`@ a̔!|䀢`2`@;$    *`  `? 2`@{`@  "P @zL  @6G +|)5' %| ,`@ a̔ܖ!|ٸ܀`2`@:    *`  `? 2`@zȐ`@&    @ C`@,`    @ 7`@,`  @zP ,`@ " `  @z@z`@& @zl8h먝㿀 j?c*! @  Z|5 a̖| A쀢`N@:u   |"*`   `? <@zQ08  "|5 a̖| 䀢`@:O   |"*`   `? @z+@z) 0 0      @z@z@zh㿐 =  (|"`""`"" `"` 2` ""` 2`" 2`"'%#@`  ڼb`2@*@& H&㿐`0#ڬ `"% ` %|` 2 `$$ !a`   *  *ڌ &` &`&`چ `"% ` %|` 2 `$$ !a`   *  *f &` &`&`` `"% ` %|` 2 `$$ !кa`   *  *@ &` &`&`: `%` %|` 2 `$$ !Дa`   *  * &` &`&`ć㿐 > < <+|'|#  @ " @ W @2@"`@4$@`a, @ & <<+|'|#  @ " @ 9 @2@"`@4$@`a,& @㿈  $/ `%|  2  $$ !&a    *  *٬ $ $ $ ٦  "% $ `%|  2  $$ !a    *  *ن $ $ $ ـ $ "% P `%|  2  $$ !ڒa    *  *` $ $ $ Z P "% 8 `%|  2  $$ !ϴa    *  *: $ $ $ 4 8 0-|+5) '| & `̔a| 쀢`@8H    *`  `? @x% @x!( 0 < <+|'|#  @ " @L @2@"`@4$@`a, @ <+|'|#  @ " @/ @2@"`@4$@`a, V     $@w  @wϐ V     $@w  @w 9 6"*@  ` $?@w`?` @w@w&`   $@w  @w@w 9 6"*@  ` $?@we`?` @w`@w^&`   $@wM  @wH@wF'`㿐 T    ,`6)$'$` +@wT!@w@w)  $`` `2` $  ,`"$` "` @w$`` `2` $" $$$+b@w+!@wV$ "&@& @ ` @v @v& T㿐 `@$$ "FbH0{@"Ɛ#@|!Ѐ`$#@'7bX0e@0b@@+` @v , Y& , `%|  2  $$ !a    *  *ׁ $ $ $ {05" ,S , ./  -- `)'%@` U P`2@I<`2y㿐 ;`72` @: @1-+$ `@& c@& ,`@%   & @&c , @ , "`  @" 㿐|. "6 ` .`6`T  V  2=?  7 5 3?V  "/   @* *`     ?? "  ? @ *b* `  `  Ͱ 㿐. .`6 6` | "䀦@ |"怦@|"쀦@  "??㿐      *`2 8  *`?2`#`##"ݒb|L`蠒 2 #"  $ 4̐,`$ `   + 2  *22`@   0|" 2` |b2㿐 @uΒ  `$̐#P`&@u’  & $#P   * "@* &   0.`4%  @u $  @uw.`$   2$̎#`@  +` ( `" @$@ -㿐`     `6@&  `? 2`!$#$#$ cp`c@%T$c@%M ` 6   `6@&  `? !$#$#$ cp`c@%/$c@%( 2X` @`,`@`"@ ,` ` @t$`@t@t@` @`,`@`"@ ,` ` @tw$`@tt@tq?@tf  @tݐ  2$@$ې"$@$`$$ 3$` 0@`-@`4@0%  @t $  @t,`$   2$˴#@@  +``( `" @$@㿐|5̖|!ɔ 㿐{ @trcӓ㿐|!x@ X " #@ 2#`0@$pa㿐@1i*|֐||"` @#"<#b"a,"4 "?6" |"!D㿐 @   $ (    @$$  @ $ 㿐j# @  $ (     @$$  @ $  (@"@㿐ۢ\b 2# ! * $ * *@ $ * $4 㿐ۢBb 2#! * $ * $ *@ * $4 H &H`" "`   R *`  㿐 b< 2#ʻ!  * *@ $ * $ + *$㿐b< 2#ʟ!  * $ *@  * $ + * $  2$ @$$ `,$ `D &`,&`D㿐 `ր2 `2  "` <0 㿐 ,   @ 2 @2$ & ,`2  ,㿐@rɐ @rƐ `2$$<!$$ 㿐`##" b?###"b|n`蠒 2#"$  4$ 㿈 2  ## #Hc` 0@ @֐ *@r @& & & 㿈## #ߒc؀ 2  ## #Hɻc` @ @ *@r @& & & 㿐 2V9   .` 2  0*  -2   @' .`+#2 c)$,`@2`  `c@"@" `  ?*$ @2` @,`& 㿐|a@ .`ԓ2`0|2` .` T  2 ƒ0@  .`@` T @ & 㿐|a@ "     0 㿐  2!   |$#  86`pd& !@`  &    x &  㿐Ғ 㿐̒ R2 *` 0  (`?     *`0   & 㿐@ `@` ,  : `  2 `,`[2``W`@ 㿐` ` }㿐|a@ m  w     @  @`2  @(`2 @`2 @(`2     &*2 `  8 㿐 T    ( `, @2;4 , @2F4 *.  2  `24  " @2&. * 8 2 ". *. 6 㿐V  ٦   @%| ,`@2@* 2   @2 @* 2  ` @& "  @  㿐 㿐 `@     2 㿐@㿐}  @`/ 㿐 q  ` ` |b @, * `:R` ` ?2@6 㿈|5 ̒| 쀠 @ 㿈@0%  |"*  `   㿐 `"& '%#@` `H b`H?`&`H& 㿐 `'%#@` м`H зb`H?`&`H֐<Ь& `D?&`D㿐 <%| #  "  2"`В4$ |Њ,㿐 `   $@o  @o㿐      $@o  @oz@ox㿐 9 6"  *@  ` $?@oZ`?` @oU@oS&  `   $@oB  @o=@o;㿈 * "|5 a̖| 쀢`@/5   |"*`   `? @o @o 㿈 8 /+|)5' %| &  a̔!|Ϙ쀢`@/    *`  `? @n] @nܐ`㿐 "   2  $$ !a    *  |*Ϛ & & & 㿐 $ #|  2  $$ !a    *  *`u & & & o`㿐    @n@n}㿐@nn @nk,`  2$ $"$ $$ 㿐 7 /|-$+$  *@ ! `'|  2 ař     *  *  $ $ $ & @n/ @n-㿐 @n   $Ŗ"Ѐ  &@n  & $Ŋ"0& 㿐`! @nw &  @nW.`&   2$n"6 &* " &㿐 @nX  2 $V"А  @nN& & $L" "㿐@  @n< &``@n, &`` 2@$3"@?*`"  &@+ ` ?? " `"㿐@   @n , &`, ` @m &`` 2@$"@6 `*`" `@&@"?㿐 $$"Ľc  @mؒ &  @m, &   2$ϐ"?.* "   &+   ??"  " 㿐  &  $ #@c0*@㿐`$@$$"kc0.` .`: &( : *  :`#@ @(( : "@㿐 `-+@`%  @m[ &  @m;, &   2$R#@@  +``( `" @&@/㿐  @m5@  $3"Ѐ  &@m)  & $'" &   + `   "  + 㿐    @l& @l㿐  @ ,` @` "@ ,`㿐  @ ,` @` "@ ,`    @l_& @l\㿐 @lǒ   $Ő#P &@l  & $ù#P0  * "@*0& 㿐 `-+@`%  @l &  @lq, &   2$È#`@  +``( `" @&@(㿐 @ll  2 $j#P  @lb& & $`#P    "@* "㿐   @k & @kΐ㿐 #       @k$ @k `"@@,`  @k & @k㿐 7 (   ` @`,`@`"@ ,`"  ` @k$`@k} "@ٓ*  @ko & @kl㿐@k^  @kՐ   $Ӑ"Ѐ  $@kɒ  $ $ǐ"$@$ $@$`$`㿐` @`,`@T`"@ ,` ` @k+$`@k(@k&㿐 @k? @k  2$@$Œ"$@$`$$ $`@&  &"`? 㿐!$#cp@h$c@a㿐 8   Ò   2 @kO 2$$M $`$ & 8$ $`㿐@j  2 8$9  8 $`  $@–   2 @k" 2$$  $$ & 8$ $㿐@j  2 8$   8  $@  $`h   2 @j 2$$ $$ & 8$ $㿐@je  2 8$ސ  8  $@  $`:   2 @jƒ 2$$Đ $$ & 8$ $㿐@j7  2 8$  8  $@  $`    2 @j 2$$ $$ & 8$ $㿐@j   2 8$  8  $@  $`ޒ   2 @jj 2$$h $$ & 8$ $㿐@iې  2 8$T  8  $@  $`   2 @j< 2$$: $$ & 8$ $㿐 8 "  2   2 㿐`8  y 2    $`8$   2 㿐@i  2&$ &㿐 @   2  &  @ 㿈'D   'H  'L  ''c̶H`02&$#&D"j&|b쀥@| %#@`|D 2 %P%0@iL @iw@L %%  "  "#`P0@i2 @i]  2獐],     +   2" ' `2l`<, `    +   2`" `' 2K,     +   22  2, ,     +   2 2 ||쀢@*` " |%% P0@h @h&  @ R`  ` `@*`| "2`@ ,`    $c   * 2  '2  H`  q  $c   *` 2 'H@>"4  `   L   / $|c/  e /  2 ",`` 2 ` `  -`  /`$]/` F /` 2 |&&& &D D)%#Ȫȥb2D@D ""㿈 H `0 ' ((2  @a `R@ 2`` ` *,` 2 @8  *`@cҐ,`2 ? & , `, 2  ?, *@&㿈% ` %%  p`0V 0 S` `'@`  R@ 2``)% )%` *,` 2 @8  *`@cJw,` D2 `,`& 4`:` M` , & 0%2      `@ 2x'P 'D'H 'L ' '' '%%!`P@g 0@g:D@Ǡc'Hǜ`0쀢2%F "D```P- @%  %% P0@fޔ!@g  @ ;| ,` b쀥`` 2%@6 `%@ `D 2 %P%0@f!@f@L %%  "  "#`P0@f!@f `2`ɒ,    ` +   2"'`2`ؐ,    ` +   2" ' ` 2`䷐ ,    ` +   2 " '``2`䖐`f, `   ` +   2`"`'`@7b쀥P`* @%   %% P0@e"@f#@6`9% ,` -  " |%% P0@e"@f`&  @ R`  ` @ * | "2`@ ,  ۠       * 2 '2  H       ֠ * 2 'H@Bb4  ` ܐ    ɐ ܔ   ܓ* 2 'b,` 2 ``  w      *` 2 '`@&Y ``2W`" " " " D``D'%#@`b`2@D ""㿈%'R `8 %%  pP`0s 0 n耢` `@]Ԑ 0'耢`'`(+%*2  @^4  R@ 2``+% +%` *,` 2 @8  *`@`ϐ,`2  D,``& 4`:``Ғ` , && 0%2      `@&   耢  2 >&@`㿈  %%  p`ϰ 0q0 n '@] R@ 2``)% )%` *,` 2 @8  *`@`[ ,`,2  ,$4        `@6 2  L , $0)2      `@` 2%#@ea @cҐ 㿈  '%%  p`P 0 0  @\֐ 0'耢`'`('%,2  @]5  R@ 2``'% '%` *,` 2 @8  *`@_ΐ,`2  , ,` & 4        `@62ఐ þ  , '& 0+2      `@&   耢q 2" %#@ɒa @c6 @_w㿈 0 ' ((2  @\  R@ 2`` ` *,` 2 @8  *`@_Kx,`2  0  ,  & Hg  0& 4& 0㿈'0  ('6  @\i R@ 2`` ` *.  2 @8  * @_3. 6 㿐  @  , 㿐  @ y , 㿐 ( &@  &@_&@2  &( "@" 0"㿐@@_J & 㿐<@@  @  & & `@(  `( 0 (@(&@6 @"@@"@"@@ "@@   *   , "@ , 㿐| 3%!Ԡ  @b/(@b* || !԰a/%-%,`` @a@b%@ #%a@y? a`@p@lآ`,`㻨)'%# @\@b}#@Ӑ@bwO`L%@b&?   * !|* !@a|%$Ԑ"@;0:|%@3"(%@0"8| a@`"%%@&!%@"!%#"H@?@b>#@@b8@a $%@a !@a"%@"`0@"0@"㿈L  @ >  :  &:$I Z@ : " * ">*@  >*  @# ?@#̔@@#Ő @# @# 0 `?,2 " 2    @>  :  &:$I Z@ : " * ">*@  >*  @# ?@#z @@#s  K$I . ` /逢?/"  * 2  <   :  $:Z@ : " * "<*@  <*  @#8 @#1@@#* .㿐  @ <`  :  &:$I Z@ : " * "<@*@@  <@* @ @" ? `@"@@"  @`  &%%"hݒbx㿐`  @<`  :  &:$I Z@ : " * "<@*@@  <@* @ @" ? `@"@@" ]*# @    @>   :  "$I: Z@ : " * ">*@  >*  @"e ?  @@"[ 0% @"V @"R0  C0 @0  0%%"!bUVhVVVVVН㿐`  @<`  :  &:$I Z@ : " * "<@*@@  <@* @ @" ? `@! @@!  `  @<`  :  &$I: Z@ : " * "<@*@@  <@* @ @! ? `@! @@!    *#T @ , і ,@`  @<`  :  &:$I Z@ : " * "<@*@@  <@* @ @!s ? `@!lH@@!e A , @!\ @!V 2 , G' , = ,  ,    %% "bȤ&m Z[ Y YHZDZZZZZ㿐||"  ` 2t@^@_   %"ؘ  $+ 2@ +  ,R""p|)")  4B#+  + 2 *  `btbp #bpbt84t ` "`  4&  #bp  *  `"bt84t ` "`  2 $bp 2㿐|b   @^  %"ؒ @6*`6`@*`&@`,["T "  ,  R , `2@ &@86 4"@[@h,`|2`"䀢 *`2@ &@86 "+ b2  *`2@ &@86 "2 2`2H?`@ |@ * P*P .?b* P + P b b* P+ P  `    ?@ ? 㿐`   2^?  |` 2V |@b   * R `+ R`"D?+ `  R `+`R`"7 + `  R ` +`R`( @Ɛ @ "?@ " `@@ 2`  @ @ ? @ ? 㿐| "t$`  @L5p2 3%/|-c@@ ] @ ``    @ ? `p @ p㿐||b*  `p`|"*` ` "`  t$!| @L`"  &@"`< #* 2@* |"* @*`2 * 㿐@ % #||bb @\i @\ؒ  2 $b%֐"$b%% #Pch , @? | ||"*"2 * b 2    |"+  + @  0   @ #p #p &@ @@ 2 2 2 2 2 @2 @2 2 !@2 @`( "@!@@ 2"2$ 2(  2 2 2 2 㿐8      @ <`  :  &:$I Z@ : " * "<@*@@  <@* @ @ ? `@8@@ 8  㿐!|'P "/` V" @"b| < #,` 2@`@&,`b|  ` 2b|` 2  R ?;%9%#* 2 *@ >*` R   b|  @2,2 /cx#6  R`@  ,|?"c|  +`  @ *  @ 2 2@  ` R`@ & ,2`@طb|%x  @ <`  :  &:$I Z@ : " * "<@*@@  <@* @ @/ ? `@( @@!    :  %$I: Z@ : " * "<@*  <@* @ @ ? `@  @ @x,` `@+ `  P @xx㿐V"p  @ > /| -:  &:$I Z@ : " * ">*@  >*  @@@@   @>  :  &:$I Z@ : " * ">*@  >*  @f@_ @@X  "p!+$I`, <@|, @  >   :  $:Z@ : " * ">*@  >*  @"4@@@ ۠|, @ T` E  ͨ `|, @  >  :  $:Z@ : " * ">*@  >*  @@Ӕ@@̐ |5|* 2  2A  * 2  8 y ` A $ Z@: : " * ">*  >*  @@ `@ԠGC `庐* |` 2  >  :  $:Z@ : " * ">*@  >*  @L@E@@> Ò"p @X%|㿐% ß#|" `"'|Hi";`|%[@ @c:# " %% @ "#@ Ȣ<##%c@ @Y(|?"b ( " (é$Icˬ `  "u Z 2 >@ 3@X  <` :  @@2 "` %Z@: : " * "<@*@@  <@* @ @ ? `@ `@@  J `?;`$   `?0d `  @<`  :   :Z@ : " * "<@*@@  <@* @ @Z ?. `@@P 0/  :  ":Z@ : " * ";@*  @ <@* @ @- ? `@&0 `@!Ê 4 '@'*@&㿐,(L  @ <   :  &:$I Z@ : " * "<*@  <*  @ @ڔ@@Ӑ `  @<   :  &:$I Z@ : " * "<*@  <*  @ @@@  @W%% #wc@&@ x @''''c<#\ܰV ǐV  %#@qc@|"`&#@d`8@@@ H D/9|'i'=䀊`    ""p/19|   / ,9|`?`` "`   ` `2` D@%#@b& D H%#@c& H D H  @ <`  :  &:$I Z@ : " * "<@*@@  <@* @ @ ? `@Ԕ@@͐    @<`  :  %:$I Z@ : " * "<@*@@  <@* @ @ ? `@0@@     @<`  :  &:$I Z@ : " * "<@*@@  <@* @ @g ? `@`@@Y #y0#\ "` !#@V2@VW :  :  $I: Z@ : "  @ :  :  $I: Z@ : "  &  @<`  :  &:$I Z@ : " * "<@*@@  <@* @ @ ? `@@@ڐ @ @&  )g洐䀢 @&&$  `耢 @&&%  `@|" &#@`8  㿀' &#@`0B @  #\  #`@ % @,`8#@  `8"@& @U$'@   @U'쀤@6 ,`8 `@@&,`4 㿐|| !aԤ @ " .@+@.``  @ @  ?㿐@U"  %!"؁㿐.`2` @D`㿐. 2` `@D} . )%    @D .#@@@@@ + ޸  @)Ԁ㿐 &@Ta  &#a(@ð 0    @Tx0 㿈 D&''Da @Tf'찒  &#@a(    @TX | 㿈|##b$    cD!L &|b #c"& `& & &    &  & D$aL# &d!P0㿐. >  ?" c ("+" e&J" d 2\&FX&""""\bĔ`###b  L#"""\c"""\c`!. #"""\`4"#"""\``###b  !##"""("#""!` !ۘ #c #$"&!xa 㿐#|b !&  !@$b ِ |"b$@㿐!|#|"$\b $"$$b 㿐| b$  $*   `'|``  2`$ "@㿐|##b$DL && !`gap|  @`"H `"`3 8(0 ""H3 8  @ "`"H 3 8 `8  (2`8 `  ` * ``   `  @`(( ` `"@@(`"` @`  @( `"     Ւ` @"   * c""c *  * c"  ((  "(Ր "`  @`(( ` `"@@(`"`   @ ?㿐@R' 2&&!&#  "0c$$4444$4&4,$4 444444 4(4*4.$0$4$8@R$@$< H$D" $\$H$P$T4X@Q4Z$`4r <$d$h$l4p$t$x@Q,| 2$&e!$@Q <  &\! $ $$@Q$&&&&&&&aؔ"b("" " " " " " $㿐@Q &2!@R3 㿐 @Q @Q @Q @Q <@Q `@Q㿐`@b*@` '  T      (2 @ `2 @@2 h2 , *@7, ѣ    * |  b (*`@ R` $`` @* @`2  * @`"   "  (( *@*  7 &㿐 e  @O`%|')+&`" ``#8bH%#4bH ,`@} * 2 ` ` +` 8$,`@| * 2 ` ` `  ,`@*  ` ` ($@Z@Pǐ  @``` 0 *@ 7$ 㿐``,`,   &&2"c@ l%*! @,`   2  e2,2 `, 2 @S 6* 2 @"T ,` 2  N2@, 2 `  ,` 2  B`?,2  9@ * , 2 ` ,,` 2  *@ 2  %`?# ,  ,` 22  2,` , 2 2`  `   && #(c@ Pp,px㿐 o  `6? .`'&%&6`` , |"*`  R 2$P *`   2  * ` "     6`  "   `2   T`  `&`  㿐 j $+|)&'& ,` b,`  ` ,` 2 @ @I"x@ T@C•`@& 㿐<  6 |  "+ `+ ` `  +  㿐@ 㿐|'H"('L'P'T'X €H㿐|'L",'P'T'X L|( (|, ,㿐@P@O|0 0㿐|"0` @|4 4㿐|"4 €|8 8㿐|"8€|< <㿐|"<`@㿐@O|@ @㿐|"@` @|D D㿐|"D |L L㿐|"L`?@|H H㿐|"H`?@|P P㿐|"P ?㿐@O}㿐@Od㿐@Nɐ㿐@Nɒ㿐@? "@` * "`@O 㿐cc? "c * " @N 㿐@OA㿐@NА㿐@? "@`  "`@N 㿐bb? "b  "@N 㿐!|"̀?#| $b$""̀ &'#` $""bЀ'' (`b$"́㿐!|!\ 2' p$!\v!\ 0@ ,`1|p'|"ؔ"@"#`  a &"&"@N $@@Na&"$@ 2`'w X`u4@L&#|!@M'| bؖb؀$#Ԁ  a $b$b@Mِ $@N5$b$ ''K X' Ȕ@MԒ#@Nԁ㿐 2 @ @N3 < 2@'1 @ &`. `. `. `& ` 6 `& `. `. `. `. `0& 0``' @M 4   a & & @M $@M & &  ' X@Mu`   2*`  ' $@Mb $4@   a & $& $@MT $@@M & & $@ 'Ɛ X@@MG`( 2*`( (' ,@M4 ,4@   a & ,& ,@M& $@@M (& (& ,@ ' X@@M` ( 2*` * e( 4`  8@M,`  @M[,` 2& 8's @& 8 & 4` + `8   8" ` + h'DH@L'H'Ȱb'  '̢  ' ' ' ' ' ' '&?#& Ȳ#@Lѐ.'@LŐD' 'Ȣa ' ' ' ' ' ' ' '&# @LȐ0%@LD' 'Ȣa( ' ' ' ' ' ' ' '&# @LȐ㿈  &@ @Lْ < 'א @  &'' !b@w.@s.@o.@ ` @LG '@LF @L@L"  `? ֒9''"lb&@S* 2` 6   s'' " Vb@L&@'  ?  . "" .   ?   `   `    '#>aH  װ ''"8b@ .@ .@ ?.  '*'*"P b  @ ' '"pb  "  @" "4$   a &&@Ko $@@K&&@ 2$' X$  $  a &$&$@KP $@@K & &$@ ' X@K  *@K  *@@ &@ ''" "b%| -&0 e+T4 8@K. `@Kq.` ' @ %|&8 &4@ a, 8"   T8 @K   㿀\|`'L"T%`  ` @@@2  0 @@@2 @Jސ '@Jݐ @K@K|$  ꟬b"&6#& @Jɐ@J4 ?$`''"pbk@J4` @ $@ @ 9@ @`@ L `@ @ `@ '@ @ ` @ ڔ|"̀`'@"@ @ ɔ@ Ő  '@  $ '@  @JŐ @J% @%  4  @ ܔ? 4 8@J'/   @J/  L' @L$8,,,$$,($4@J4@  a $$@@I '@@JT$$@ 'j X@@I 2*"( @Iڐ$4  a $$$$@Iː %@J' $ $$ '= X@I  2* $0㿐 '#"b0@*'@+'#@+% (@#'@+#(@+ @'@+#@@+ @'@+ #X@,   2''@+#p@*#x@'@*#  "''  "'  " '0("'0%" ( e" '0@*ݐ#@*ِ#@*Ր#@*ѐ#@*͐#(@*Ȑ  @*Đ @+ @(@* @+ @(@* 8@+(@* P@*u@㿐 @I < ' 㿐 *|"|"T2  ''  s`0 " @I " (@H ( " 8@H 8 @H@H㿈?''&@a@I  '#Ka$ @ .@  &@@H@  e   ' '@#(aذ 㿐Z|"́㿐|9  1|"T㿈| " ) 2 @IG @ |"T㿐  (|"T (`& ,@Hq ,4@   a & ,& ,@Hc $@@H (& ,& (@ 'Ր X@@HV0 ( 2*㿐|bT  2 0(`X0   (`(` Nz  "& ?   && "&&& # ##&##ؐ#㿐&@Gc & @Gc  &c@G  2?0  "  ?   0   㿈@G '@G @H" 㿈@Gܐ '@Gې @H@H{" 㿐|  Q 2㿐V V`"2  `  ` @*2 @  & *`2    㿐V `2)   A` . <6`. <6`220" : ` /   8@  ((0 > .@)8㿐. 6   *` | 0 ?@G 0K2` .  R2 |"ꀦ ( @G8 07  i  (+& < @Ga ,< ,    :@GN`*`:   >. > 㿐. |6 "䀢 |"쀢  |  0J?H "怢  | ? .`=.@"ꀢ |9( @F0?O ,.@N `#* @  ? ( @F?㿐|. b6  .  R  ```(P(" K(@ΐ* @ڐ* 2 {B? <..  . @`&  :?. *` .`  T& `@& ? >. *`  ?( an?㿐( a((a8(~ah(za(va|b  9 5(3(/(-(+(,2c, ` R`Yb ` R`K @ b00b0?*`2  Ѧ 㿐 N   @J  F  B  F  ` @  `  ``?" -   .$(0* l @         (( "8̒bH0( "8ƒbH ,444444444$4㿐 2ذ   @Ӕ  2а   F  ` @  `     ``?2  C P N U D R S E`  `  .`       2   @ . 2    `  (( "Rbh  @    ` ` `?`2D   C2 `H 0_ 2   `@`.`2   `  (( "b  @    ` ` `?`/ ̀``* (( ?  R`  (( #c00`2 ((   (( #c0ذ 0 㿐  61*# @(cH2(ܒcX,(֒c`&(Вcp (ʒc0(Œc(cP(c ((#c c` ` *  (!(c # Q  `: `  . #  .     1*" @(rc )l` (fc )`` )( 8c 8))Q`0L`@F#T$<<<ƜƜTld|ĔĬ㿈@C  )/ X $4      2   @ . 2   2 (( "b `*` |@4@,     ` ` `?`"  D B "A4    2   @ . 2   2 (( "b , ?  @4@㈀  W (#b`4, 4㿀|b܀   !)  d@C x!$ c $ d4@C~4$  `!|)u h!|#|"&"܀ $b)P $"|)"@j` W|)"@c` P|)"@\` I|)"@U`Ȱ B|)"@N`ఒ ;|)"@G` 4|)"@@` -|)"@9a &b|( b#2 @%$c(b@ 2$c/@/@耢  W怢 (#b`㿐!# #@|-|<$##@wc|$c"`` , "  "T @BuT  2 @Bo 0@Bl@@Bj @Bh ,@Bb@@B^@B\||%2""b||2"2b||2"2b||2"2b||%2"2b㿐?`#@ ) @Q!00`@(4@`@ 8  ` @B*` &` ) !(06`4@, -2 -#T@? , `  "@ ` 6`) ~!@x` @ "4@ |7--bܖ#T'Ȓ?2 <c  `"4@@Aڐ  $ 4 ِ$ |" <c4@p "$  $  4@ p<ؒ#2# 2`|'--#T7' ~7܀?2 5@  5@n@A |,6@ 2 6`,` @ R  !) " c?)ΐ!-"2 ` .R` !) " c))!@A] @AZ 4 "@2`$ $ $ " 25@ 5@ !"6`   `4``#)@ca,  4 )a)a㿐.`. .2 |"怤@ )%|,` @R  !) " c̐)[! @R  !) " c)I! 4**2`12p .< >#@/|-)+)),`:` @ , R` c ! `*`:  |,-b-7#T' '7܀?27  7`,> @@,   `,`:`* @ :  4  @@>@@ 6`|"2&` &`G&` 27@ 7㿐@  |`  ??  *<@ 2` *< 2`   2  2 ??bܒc R @2`*` "*` <V  2   2  2< c4@  ` * < 2` *  <2`  2 2 㿐@@ !$ ?4 4 @@q$  $  `)h hx` @ "4@ |7--bܖ'#T?2 < c 4@x -7-'#T?2 | b 4@x -7-#T' ?2 | b 4@@?  4 $ $ $ M <c4@㿐N@  |"4ڐs㿐J@   J` |"6a 㿐 @   ` 2 @|"#6  `? `  `  |"6 %  ` 2` ` 2`0 㿐)b0@? )@?b8 2N@|"4 %2N@N` 2`N@  |"4l㿈.`/逢 /|"6Z㿈>`////㿐#/  T ( #Gb`㿐㄁㿐@>°@?" %  㿐 4?( @> ?* |2  *`P * |2  *`P | *  0 @* "0 * |* 2 `    *@@  㿐|. "6  ` .  `)`P (b0* 2 ` ` (` * 2 ` ` (` 㿐  @ ,` "`  "T @>T  2 @= 0@=@@= @=`@ ,`@=@=㿐)?aXQ#),!㿐?2 @)b@>#@=   &@㿈 '@> @`&@'㿈 '@> @2` '&@ 㿈 '@= @`&@㿐 @=?2 )#bX@=n  &㿐. D'D @=  8 )#bX@=X  &㿐. D'D @=  8 )#ՒbX@=B  &㿐'DD @=Д  8 )#bX@=-  &㿈|.` "` @ 6 `C2 2 |a, )"$$` 2     04) 7)"jb/      04) 7)"Wb/ 2     04) 7)"Eb/       04) 7)"2b//!p <|#a4 24)G"4$ &!p` 2!|a, )5"$$`!Ԁ <|#ua4 24)#"4$ &!Ԣ` |ca, )"$$`*  2<|#Oa4 24)"4$ &` |=a, )"$$`*  2<|#)a4 24)א"4$ &` |a, )Ő"$$`*  2<|#a4 24)"4$ &` |a, )"$$` *  2<|#a4 24)"4$ &`  π ˀ `)4@Z"؁㿐  @B|"䀤@ ";`|"怤@ 5,`  21`|,` @ R #` ,`4 ,`22 * ,`=2 * 2 ~`%* 2 v/* 2 p`@|㿐||"`J |"  , , #|@;$@;$c @;!|$@;#$# )# ,)#,#2   |||" b+ ` 2 R `2   `@ 0* 3 2`@ 0 5#㿐`28 @ < 2h <  wV@ ||a, 2)" $@%||a4 2)"䀦 6@* &`$& <6 < 23 @o  BV@ ||a, 2)" $ %||a4 2)o"䀦 6@* &`$& @ @㿐 ? / |||Q(` 0 0&/`04&b.  P/` /`"0@/` "/`(@6@&` (0ɂ㿐@|`(7 @F5|.`  = `@9|5||P@2` ` /`/` " / b02 @䀠2`쀦@ .`  " `(1&``@&P@㿀|" `* ' @:'讒 2 )#   g&   ` '@2C  ; @:  2`)#p`` 6 & & c "  O7| #;)U ?, '4@@9$` $`)oc0 "  @2vHB䀢6 " ,4 怢|" 4 `24  )#@=)cHcX" ` *` *    5   @9$  $ )##0* @*` `2@9㿐@2 2`))#c`  ` ;|Ȑ7|`-  2`*` ې  *,`@8  * 2`@ ,@9[ 4   @9ϐ @9ː` ,`)Đ#,`&` 4 &``2@9:&@ 2)#@9 2b)#b*`$ % U$Dž쀢 2 `|mh "`@9  2)#@9 2)#* $%$ ` # 6') @8  s【@9l 2$`k$`- $@2``   ** %3 `  =-  2 * -*  @*`   $ 2 > ,`2   |*  @  ,`b,`2,2 *@ *`   $  *  2`@ Ǩ] +)-  2 @M*` *     @8*  $ c6$   *  2@  $ 44,`2   |*  @  ,`b,`2,2 *@ *`    @8S*  $ ͐c4$  *  2@  $  * 2`@ 㿈N€ a<]#|?"c2NJ " " "J D  % J   ?J 0? *? # * @`@  2  `` J %`J 2`2 2 N  /d/ N 2 㿀<c\ `7J `&P  &J 0 |b7"& " JN@ %2JN` 2`J ?# *   "3&2 ?#@ `  /& /逤`" J`&J` " " " "o J :f7 &J `&P  &J 0 |b7"& " JJ@ %2JJ` 2`J ?# *    " 3&  2 ?#@ `  /&/逤`" J`&J` " " "   S0 4 㿀%   @7ǐ< 4     I  0`| b@4` % ? ` 2 ? # ? * `4@7?#@ @// # @@7k㿈|# <J' #c<'#㐒"煔 1$c | J`" J`  "` `c J`c c `6J $c S $c J 0 `|b6%$c 6[ `" JJ@ %2JJ` 2`J ?# *   "6$2 ?#@  /$/逧  J`$J` " " " c "!" $ @6?""@ $c $c `?㿐 a&! 1 ` 2 ?,*  : :`@2` )|, : "` * R ` v  @* 2@ *`:  㿐 ` $" @b 2   @   2  **  8` 0P *`  **  *`0BӐАV@   |4a, 2)"&n5||$a4 2)Ґ"䀦`4* $ &Ɵ `" $" @b 2  @  㿐 < @ c2& @& <㿐j=T   |a, 2)y"&%||a4 2)i"䀦`4* $ & 2$@$<㿐 T  F |a, 2)="&#||ba4 2b)-"b䀦`6* &&ې㿐|ga4 24)"4$ 㿐6.@4&  & )#0㿐`2    2  &    2 ے &  㿐)cߐ#` *N#@4° `4N*#В`㿈<c6J  &Q  &J 0 \|b6#&\ " JN@ %2JN` 2`J ?# *   "6&2 ?#@ ` /&/逧` J`&J` " " " * |2 * |2 㿀! . /c/  && ,    2@ 㿐 , `O  D@4B 2  ,**  2`0A `@,` D**   `"& D@4 $ @ **$!` & D @#?  "` ,  " @3& ,㿐|# -#| )c@ 3%ۀ`$c, #`@&# `%ے c`$c#* c#@$c$#c $#  $c㿐N#| "  #c)%*c@ `-@ $c!|###㙒@# $#N `,|c c@ %ۀ&#ΐ #`@$# `%ے #`&#c* #c@&#$c㿐 'H%|c*H L "   #c+'*@ `- $#|ccc8@c $cL  @  @  ,!|#2 # * c#@ .`. $!|# # ` *@# $#*!|#@ H$#B #`@$# `6 #`$#. ||#@"}$ޔ㿐 ۨ"gc  '| -+*^@> :  " * @*`& `0. $!|##⦒a@# $#^@: " ݢ`.@ @.@ .@&@ 㿐  * 2 fC*# @|  F#C!|I#|  E|  D|  C|  B|  A|  9| ߘ 8| ۘ 7| ט 6| Ә 5| Ϙ 4| ˘ 3| ǘ 2| Ø 1| # 0ے#"* !|# # *# %a@# $#`*`:             p ` P @ 0  㿐  .2 n,`D*! @|  F#J!|P#|  E|  D|  C|  B|  A|  9| ߘ 8| ۘ 7| ט 6| Ә 5| Ϙ 4| ˘ 3| ǘ 2| Ø 12|:  | # 0ے#"* !|# # *# ᗒa@# $#2 `*`:              | l \ L < 㿐 | # ے#"* 1|# # *# Za@# |&#"`@| c#  ے \#* $c!|# # *# 8a@# $# c# !|ے u#* $c# # *# a@# $#  09 c# ے#* $c!|# # *# a@# $# c# ے#* $c!|# # *# ߒa@# $#㿐_w  | # ے#"* 1|# # *# ිa@# &#| c#  ے \#* $c!|# # *# a@# $# c# !|ے x#* Q$c# # *# |a@# A$#"`@| c#  ے \#* $c!|# # *# Za@# $# c# !|ے u#* $c# # *# >a@# $#1/ 09 c# ے#* $c!|# # *# a@# $# c# ے#* $c!|# # *# a@# $#㿐`q m `%" @/ې a ?G*! @*J!`W!  #c!|%#*@#@``- $#1|##a@# &#N@ 2@03*J!`/!  #c!|%#*@#@``- $#1|##ߙa@# &#N@ 2@0 *J!`!  #c!|%#*@#@``- $#1|##qa@# &#N@ 2@0*J!`߲!  #c!|%#*@#@``- $#1|##Ia@# &#N@ 2@0*J!`!  #c!|%#*@#@``- $#1|##!a@# &#N@ 2@0*J!`!  #c!|%#*@#@``- $#1|##a@# &#N@ 2@0k*J!`g!  #c!|%#*@#@``- $#1|##ђa@# &#N@ 2@0C| c#  ۔ "#$#* 3|c2 c *# ޮa@c &c2 ## 1|۔ "#$#* # # *# ސa@# &#0  x   8 X                   㿐|b䀦|| |## cے###y* "怦 !|| c# 1|"c# ?g* 1|# # *# 9a@# V&#"ꀦ **J!Ȁ`M!  #c5|#!*@@``, &1|##c!@# &#N@ 2@0)2 ` ` ` *@`!` `@ ` 0 s`@ ` 㿐|a@ :|b怢  |* ` a | c# !|"c# :* # # *# ݱa@# $# b怦z|. ` 8 0q| c#  ۔ <#$* !|# # *# ݆a@# $#.`: `3   #c+|)'*,`b<  ,  *   `@ :`- $!|###V@# $#`*`: ڢ  # !|۔ >#$* # # *# 4a@# $#㿐`#|% c#3| f* $cc c *# a@c &c c#3| s* $cc c *# a@c &c !c c#3| -* $cc c *# ْa@c &c & c 㿐    -|'|# )|, |䀢 |"怢 , * @ R`2`  >   Ɣ  `m;|!|#@U X$# #`@$#O * @ R`2`    ;| ;|  `**`  ;| !` l    `(!|c#@ ܢ$#ܜ #`@$# `ܐ #`$#v-@ #@%#'c s, 8㿐V  M  %|+|#@|b *@R``   `  *  `)-|1|#@ J&#D #`@&# `8 #`&#- c@%c%0P M%|+|#@  A`. |2 ` + R`2`  S   ۔  `)-|1|#@ &# #`@&# ` #`&#- c@%c%&@㿐 %|'T*!` ! #!| -* $# # *# Ta@# $# & } S$㿐'|)Yzi=*!s ! ##|# -* $c c *#  a@c $c & #6  ݐڐ  *!*!*a㿀 `)|','|#c  )%" #`@$# ۀ `%#c* #@%ے ( * 쀢 %#耢'*  8?`4|#c   @% #`@$# | |Ր `%|cې ڶ* |||#@"%# #  (ۖ* %#!|# # * cW@# $# @k-|+|#9*   ,`|b+   R`2   ϔ @X @61 `,`|## @u  @%m #`@$# a `%G, c@%c%##  ),` %#!|##!@#` $#@$ 쀢7 ## !|۔c )* %## # *# ʒa@# $#`+|#c   % #`@$# ۀ `%ے#* #@%%#㿐-|;2 22 `2 2 `2 2 `2 2 `2 2 `2 2 `2 2 `2 2 `2 8 *."0J"0 "   c#`)'* @`. %!|###7@# $#L@ 2 @*b(t m@8*/"@J"@ #   #c+'* @`- %!|##c@# $#L@ 2 @*b(9 2@8*/"HJ"H #   #c+'* @`- %!|##c@# $#L@ 2 @*b( @8*/"XJ"X #   #c+'* @`- %!|##c؆@# $#L@ 2 @*b(Ò @8*/"hJ"h #   #c+'* @`- %!|##cK@# $#L@ 2 @*b( @8*/"xJ"x #   #c+'* @`- %!|##c@# $#L@ 2 @*b(M F@8*/"J" #   #c+'* @`- %!|##cՒ@# $#L@ 2 @*b(   @8*/"J" #   #c+'* @`- %!|##cך@# $#L@ 2 @*b(ג В@8*/"J" #   #c+'* @`- %!|##c_@# $#L@ 2 @*b( @8*/"J"Ȁ #   #c+'* @`- %!|##c$@# $#L@ 2 @*b(a Z@8*/"J" #   #c+'* @`- %!|##c@# $#L@ 2 @*b(& @@8*/"J" #   #c+'* @`- %!|##c֮@# $#L@ 2 @*b(  @8*/#J# #   #c+'* @`- %!|##cs@# $#L@ 2 @*b( @8*/#J# #   #c+'* @`- %!|##c8@# $#L@ 2 @*b(u n$8*/#0J#0 #   #c+'* @`- %!|##c@# $#L@ 2 @*b(; 4"8*/#@J#@ #   #c+'* @`- %!|##cĒ@# $#L@ 2 @*b(  8*/#PJ#P #   #c+'* @`- %!|##cՊ@# $#L@ 2 @*b(ǒ  8*/#hJ#h #   #c+'* @`- %!|##cP@# $#L@ 2 @*b(  @8*/#pJ#p #   #c+'* @`- %!|##c@# $#L@ 2 @*b(S L 8*/#J# #   #c)%* @`-@ %!|###ܒ@# $#L@ 2 @*b( Ҕ*#J# "  #c)%* @`-@ %!|###ԥ@# $#L@ 2 @`*| c@ $cې #`@$# c`ϐ c`$ccԵ* c@$cW % -  /c%c  o㿐`S*"l @ 9|  / ##!| -* '## # *# 8a@# $# & #a@ `| c#  ے '#* '#!|#2 # *# a@# $#  ##d!| '| c#  ے "#* '#!|# # *# a@# $# i     ##1!|s " *9| a  2`ƒ    $`| c#  ے <#* '#!|# # *# Ӛa@# $# @7 ##!|- >| c#  ے (#* '#!|# # *# na@# $# @  ##!|ے )#* '#*9|J#`##  #c)%* @#`-@ '#!|###9@# $#L@ 2 @   ۮ -|#)| `! |##@ @ g $` #`@$#D-@ #@%# '#k`*9|/Jc "c  #`'%* @#`- '#!|##ܒ@# $#L@ 2 @ 6!# ##!| -* '## # *# ҹa@# $# & #@ ##@4!| >, `'## # *# җa@# $#`,|#c  /ۀ$А #`@$# /ےÐ `$#ҩ* #@$'# F GP G H I( I J㿀 'H?'   U*"h @ - H -|@ "% ## -* ###|c c *'# a@c $c & # Ei -@b -   W    K *-JcȀ $c  #c%|/+* @@``.@ $!|##Βa@# $#L@ 2 @ @   C     - *a       |  <c# ے#* ##!|# # *'# xa@# $# - 'H ##3 >9!||  (c# ے#* ##!|# # *'# Ga@# $# - 'H ##  )ے#* ##!|# # *#  a@# t$#*-Jc $c  #c%|/+* @@``.@ $!|##a@# $#L@ 2 @  @@D %|3|# |`'S H '|#@ H@ !$c ' #`䀢@$#. 'c@&c##@ Π ** #wc쀥 6<H 6||#c H  '%$c`'ې #`䀢@$## %ے'̐ c`$c#* а'c#@$c##쀥$  P< U< N O O O Q@ Q Rp S㿐|!x/ @ `   ͐    /A 8 e  #c+|)|/-*%|     :, $!|##@# $#` ( !|#@  H`$#B #`@$# c`6 #`$#c, #c@%# w$ޔ  2@  ?㿐ڐ붔#|%*!  !c c#7| -* $c  *# τa@ & & c쭒 냔T㿐"""&@ >`^@@: "  ** " "*K&@ 0*F" ||  *#㿐 "#||c%#@ @ ϐ` $#ω #`@&#cm* #c@$#$c㿐 -#||c c@ i%ۀ`$#b #`@&# `%ےU #`$#c;* #c@$#$c㿐N #  #c#|'%*c@ `-@ $c!|##ג@# $#N 㿐R    㿐    㿐|!x @ `   !    0섐㿐| #41|ے#"* # # *# pa@# &#㿐*!`i    㿐 "?  #c #|'%*c@!|`-  $c##:@# $# ?㿐 / '|-|#  %|` 1|#  g &#a #`@&#E-@ @%$ ڰ㿐#|  % c#!| -* $c# # *# a@# $# & c  㿐|. b6  .  R`2` Z0 㿐|. 2`"䀢@  . |2` .  R` 2` <0.`@ |"䀢  * , 㿐1阔㿈+ 1/ +" a(|`y" z_  8  tؒ "!  2  eb +aP Ė $Đ$J 1 2J++#`@G+C``ߐ + az%$Ĕ(5+ + a$J -"J  ֖ 1*`:  `J    " @Ĕѐ ++#a0#a0!㿐 8` +#a0[ )'+%++-|֐`zR#А  +b bB @%@ 8        +#̽` $b+b0 %J n+ 8`  "@``  +̉!0` ̗bP㿈 8 1`/+#̊b`0Ƞ  )%+++-'|m`y#g`  + bxٖ` $@0 8        +#T`  8`  "@``  `+ aP $Đ$J 1 2&h++ by$Ĩ+b0 $J nF+L+ + pb$J -"J  ֖ 1*`:  `J     @+`b0M $J n +Ő+` ВbP ++#ɒa0#Œa0˰!㿐 8` +#˶b0U )'+%+˜`y#˖  + bؐ"|`9" @\  8    `@   +#ˀ`  8`  "@``  #xڐ+hc> N 㿐 8` *#Uc0 '%+#+; x5`  㿐!+#`:+6`+2`+.`+*`+&a㿐 8    `@   +#`  㿐  [*" @++&#H+ cx0|!+#+ u" !+#+ xnܒ0b++#qch0[  #+wՐL  `1J  2J +ʷc(@Ex@c007+ʬcȒ@= +ʥc0++ʠcؒ@1 +ʙc0+  ʒc @ `%+N@ʇ   ʁ0++#qZch l m k l l( lX l m< ml m㿐Ѣ ,f`   \*! @ ,` L` ,`+ cxK`!+`#C ,`+ ts!+`#4 ,`+w ,` `)+ w)L  `1J  2J + c(@$ ,` `)+wL  `1J  2J +c(@v#0wqF+`ےc ,`j +Ғc6+`˒c ,`Z +’c&+`  ɹc,` @ `)+L#@ɬ  cɦ ,,  p~`(`@/` oP ql n n n o o p| p p㿐    \*" @.`.` ?  @& @W &  2  @ & @ @H "@  &,p^ h r r r r q r r r r㿐 @"?@ː 2,pD X$` $@,  " ]*  @ ,`* ` * `"@ ` @" @ ` "@ @Փ,@ @``& &@&  s s s s sT s sx s s㿐 +@c  @-@㿐 +@c  @A@㿐 +@c  @V@z㿐 ` | + ȝ#0#"# 3"c@ #  b`>`L#  㿐 `2 & 8  +w# |"# #"c3@ #  b``L#  㿐 `2 8  " #,!,uY`8 MS @   㿐@ϐ  2&,oH H&㿐@Ð 2$ ,o< X$ $2   @ *` `@ *` 㿐u,`8 , `@㿐 u #+L  `1J  2J +c(@zuuc0ժ@?  "c` ȸ   "h^.` ? L4$ : c@  ,@Ԑ#8  @L@J  c@ 4 .` * * ?`#.``   *`  ?`#`   *` ?@  p,,?"XR < ?@%`a %, xJ   $,. "R @ ,,"R ? , $1 ?%`a$@n,!R 〦,. !R   "* @?`_*`# @ "#" @@ """""`L,#P,#`,#p@ې?%"b@  $ @,  `|, @|  @w [$@r   @m  @h  $@`$ , @#[,, @#U,, @ސ#O,, @ؐ#I,@H @B$@B ,@ʐ#@9$7@ 2,_@., Z  @,  `#,     K@$ R?  @ "@` *  @"?,,,!$@ R,`?$ *`$@TR   ,,"R @ ?,"R ?,"H*`R  `h-` @d'`h   7?%2T,X?R   􀤀,. "R `퀤,"R   ,߀ $`aL$@  @@   @@  {d {| { { { { | |4 |H |\ |p | | | | | } }, }, }4 }\ }d } } } } } }ܝ㿐- (@ 㿐|c "-||"c 2| "| |""c #"c @%@k+|#%c !ᐦ.| š@ "!"a-1."  /a!)// .+`* P@     *V  "!+`V`v* +` R@ *`S +`P@!* V@"@+`P@`%!-Ḑ"+`R"!--?!`@?|#):  |"c᠐  ᘰ?"+`S ᠀`* S ᘑ(T 㨀 ߀᠘ |"&$a$*.%c? b* @€a""a" $Ua J `?K"  a J `?"a@Y!@yaa w*?  a J `?"a!@D @daa *?aa   a J `?";!  a J `?"!`*!a a *"!  a J `?"! .?$a&%c$*.  %ca J `?" a@ !  a J `?"a@ް! aqe"a  a J `?"@aaJ@ : `qM! "a  a J `?"!  a J `?"!   a J `?"!   a J `?"!   a J `?"!  a J `?"~!  a J `?"|a c@Di a ᬐ&.? $  ) | %!c# $# ! c a@%c@e ac  *%cec@T " !   c# c@5$!  |c?a2 %c :  ! |@.ca@%cca !@ @%cc-a3@! 8 , , , ` $ T  㿐|#|   `  c 3@!8 ` ca"   a" ?` .  `$ 2` $["`"? !3@!p 4` 4  *)|#@? "@@ `  "`  `* # `* 2$|# ` 3@_!$`!| @#  $# ` 3@L!"`ᰀ   ` | @gc" $ $* `ᰐ * `%a㿐|3|75;| c3c&᐀@E&a-11./"/.H@@( / `R(T@ ⨈/ R v.`/ P@(QRa(T c@ "a.*`R1!(R  /.⨅*`S@`v* *`R(R *`*`b/P !(R`v`? 2    ᘀ   㿐||c   ,c` ##`  `     *c`8㐖" ` `   @ "`3@g!ؠ?,$a ,$㔁㿐|%| ᬦ c*cJ 2 ` #(*a"o$#   # #|@]c@O ?!`||@Pc|a$## * # `?$# ,# 㿐` @J 1 J + @ ( 23@"(| & @& & & & && & & & $` | a*a" " @0 "!㿐!|# |@6$##@^@㿐|  | a*a" " @  "a㿐|;7|5|9'a&&#/!㿐@ ( 2`3@!`@& & 3@! @& 㿐 |c""c  @o @m㿐@ &` & @`   & &  | "((#"""$||"! "c#! @*㿐  `N 2`@㿐`@!  3@%"X @@ , `@& *, 2 3@" &`㿐@7㿐@;㿐3b@##@ JH%""*H * 㾐 逦`` ?.#`^ $r2 ^  $ ? **  ? **  ? ** .@ ` 0&@ " ? ** "@ߐ&@@ $@`&@ @$$@$@$``$`` x$^@8@  &@@  ? **&@@$ 2$"* "@  @* "@: @ *۲㿐#|qa 2K0   @ & 3 |@fĀ 3iaԞ3"fVbЁ㿈``'D@, `$` ` /|-|,`2 @ fƐ 7ސ`4 *` 2  4 C/`;3` ; ?#7|5|13/3?,`2 @ 2" f  7̮e7  `4 *4 2  ܢ  /`D  2@3#ec(/`D:ͥ x33#8e֒c`q   J<+|)|#7353/3-3 ??",.7 ,2` ސfCa 0 2 @@X0`f.a "7F0 e7ސx`e pސ* 2`@ `33#ec`q*  `f "q}q, 4 !*  2 T  0 qi7* 2 qm''㿐-@l   3ej# O3|/3, b*`  T `2  @S   @N   $@eK㨑,$&+$`@ Đ @ ,`@    ,$ " `" $ "|"(2*  @ *`* 2` *@$ &,㿐ΐ  @  2$3e #$ @   3e#  |"?%%  @ * `  @ +  *``  R ?)$  @ א  @ Ӑ  3dΐ# $| "+ `  + *  ` $ $B$㿐 ` 0  `  @  ``?|"/6 ` ?  `  @  ``?|"6 %  `  @  ``?`0㿈|.`b2  @6R` ` ` :2`@ 2`@"`` 2.`` "z`.`j!`|#耢@%|  |`4 "  @ "$"#䀢`@ * $` @ *`$i :.`li `2  E  :20  2,   2!  $ !3#cj_3c3c 14`) 4ْ` 0  ΀ : 2 0 ` 2t`@ 2p`㿈 @w-|~    ` K?4@` ` >* 2 @ %| 5* @ 2 $*  @ x2`$  |#@?*`2  ` ,|#"   * 22 2L& v  ` |"*`     b*`   R  2 6 㿈  6   Ր 48  +|@ 2b,`  T `24@ @u @p`@*@&㿈 Z V@ @ P|    4`(#@*@<$`24Ґ P   o 4@` @!?# ,`@`@  $@ & ! 㿈k ` t   @5`4 㿐|'D "   Y  4b  DТ  9  @ ,`  Ȣ` @ ,`D$`?? -  `k ?6| "@ R  4bP `V    `N  D `-  ,   $` * &  2 Z  * `-`*@2`! `% ` `  @  ` ` ` `$``` "` `2` 2 _ `& `"` __ 2 ""   * &`"  `_Ő_$`2  2  `2qgD |  "b  *  2@2CÐ$|  E ` 2$    - "    - "   q$ Ĩ _G@ ؐ ?#D - @  "㿐`~Q 5 ` *,  @      -   , ` 2 , 2  & $ۑ,     , `,А " & &`@ @ Ɠ, & 4`ߐ & `q,`  ` , @  2 "@``q  4$㿐 'L`2 V44? ``V " c  * ` 4 @ ` 2,`4` Б,` <@`   .`57454*  @?-`*    3`@ , `A, 4&@ڑ*-  Ȓ5L"@㿐V 44!`$a  44!8`a   ,@&,C #4   ,`%a ,$  ,@ ? ,`   $ , @6  ,`` ݒ $ @$  +4)4,@ ? ,` ,  +` `2@  @$  aH_! ,㿐 ,`"* `! +)'* @` 2$$` i0" Hi, H?& H 2` `2`   `0` +|- 2 *@ 2" 4a@  #|b @R` 4`  (  " b`  @   *`2 ը 6 㿀  4#jah0y '?ѐ* @ 4_Y Д$`@ $`@J |"@D   4_@!  +  + *`  *% &@* &@ +  |[|a|[h0 >&!4#a4a@@㿈k~ P 2 $4 #b80f d| @ 4#Βa| ̒ |h  @ `` 4#b  44"`^b   ,     *kv `k , @ *` 2@ ^k3%$㿐 j  2$0d 2} 2f  @`  @[&  && $`@62 )4'4` ,``"$$@*`⸔#@"@! @2 $  $` * "@ $,` 2`*  $``@&`  @ ,` ` R@@& 㿐 "L  2 F 2@|@  &@    , *@*` `"! R@ "     @,` * `` (  ` @*  `@ &`  `&` 㿐`$| "@   4#$b!4#b4c  |hh  @ `  4#c8~ϰ`@44"`]Qb| `"@l @h @d  4]]#` 6   *    ` ,6  * 55   6' ,` @*  *` 2 `   6  %, `  , *  "֐&` ,"* `"" `*  "` ,@`"Oq & ``2` 2 ` , *  &` @c@a@_|!"|!h`%$% ?%$%㿐  `  ` *2 *@2` * *`2   * 2 ^  ,  * 2  634/4 , 2 ,  @cx[㐀 ,` 2 * 2`@ -`2  ٖ㿐  `  ` , 2 *2` *  *`2   * 2 V  *@ @`7;4 74, `2 `4c[<  6/4-4, 2 ,  @[*   ,` " * 2`@ -`@2  Ϡ㿐  `  ` ,`2 *2` * `*`2   * 2   *@ @`!)4'4,``2  `4 #Zޒ   ` @*` " `@* 2`@ 㿐   @` $   ` @i?㿀 '''㿐|l @ 4 #a0   &@㿐|Sh  @ `` 4 #ib0&@ 㿐!@ 24[_ А$ $ 㿐`  @, @ "# @&`@&㿐 ,`(` +)'*  @ d" Hd H?& H" 2&`` `2`W㿐 ,* !  $ `* @`" `@6,``  ` " `@  2 $ 2!@ *@`㿐 "/  2 45 )`@o#@€ € * * @& *@  &`?`"  $ 6  @ ``?㿐 2 -  2 45 )`@,#@W€ € * * @& *@  &`?`  $ 㿐@|c +  @G  $c5ZE c@"@ "5   5 @J "5@E0 (@c"`5@֐ 0c"`"` 㻐|c  c 55 В`Ȭ @ 5`@  5@  5@`5a@@   # @b ?L@ ",@ L@L "  " L z * :    : =2 LL "  " L :  = L "  " *@L   55!F@ a8 5c  @@:c3"`@aH .5 @w`H  5 @p`P 5  @g`X  5 @``` 5  hE?c" "ה hOc "@㿐|#  ## 㿐/  ??㿐㿠㿠xfstXFSTFST %s COMMAND-LINE OPTIONS: ------------------------- -e "command" execute the command before starting the application. If more than one '-e' option is specified, the commands are executed in the specified order. For example: '%s -e "load foo" -e "reverse net" -e "save fie"' After the commands have been executed, %s starts in the interactive mode unless the option '-stop' follows. -f scriptfile execute the commands in 'scriptfile' and exit. -flush show output immediately without waiting for a carriage return. -h print a cryptic 'usage' message and exit. -help print this help message and exit. -l startscript execute the commands in 'startscript' and start %s in the interactive mode. -pipe execute without prompting for commands. -q operate quietly. Don't print unnecessary messages. -s binaryfile load 'binaryfile' and start %s in the interactive mode The file must have been created with the 'save' command. -stop stop %s without entering into the interactive mode. Any option following '-stop' is ignored. -v print %s version number and exit. -e-l-f-sCommand %s "%s" not executed Because quit-on-fail is ON, any remaining commands are not executed. r%s: file not found %s -flush-help-stop-q-pipe-v%s %s 8.1.4usage: %s [-e "command"] [-f scriptfile] [-flush] [-h] [-help] [-l startscript] [-pipe] [-s binaryfile] [-stop] [-q] [-v] Interrupted Broken pipe Do you want to exit the program (yes/no/info)? %YCopyright Xerox Corporation 1997-%s Xerox Finite-State Tool, version %s Type "help" to list all commands available or "help help" for further help. bye. General: apropos will help in finding the command related to text. Then use help Some commands have built-in aliases. They are equivalent, that is, help will give the same result. Some full and built-in alias command names can be abbreviated. When in doubt, ask `help' to list and explain valid abbreviations! help variable will print out a list of variables that control the behavior of the interface and some finite-state operations. show shows the current value of the variable. The 'set' command can be used to set a variable to a new value.Operations on virtual networksOperations on networksTests of network propertiesDisplay commandsInput/output and stack commandsSystem commands[A*] denotes the set of strings that consists of zero or more concatenations of strings taken from A. [A*] is like [A+] except that it always includes the empty string.regular expression [A*](r$egex: )?z$ero-plus $netregex: zero-plus net[A.u] denotes the upper language of the relation A.regular expression [A.u](r$egex: )?u$pper-side $netregex: upper-side net[A | B] denotes the union of expressions A and B. All the strings that belong to either A or B (or both) also belong to the union.regular expression [A | B](r$egex: )?uni$on $netregex: union net[A.r] denotes the language or relation that is the reverse of A.regular expression [A.r](r$egex: )?r$everse $netregex: reverse nethave corresponding regular expression operators: @pl, @re, @stxt, and @txt, respectively. For example, the regular expression [@txt "words.txt"] denotes the language consisting of the words listed in the file words.txt.regular expression [@txt](r$egex: )?read t$extregex: read textregular expression [@stx](r$egex: )?read s$paced-textregex: read spaced-textregular expression [@re](r$egex: )?read r$egexregex: read regexregular expression [@pl](r$egex: )?read prol$ogregex: read prolog[A+] denotes all the strings that are composed by concatenating strings of A with each other any number of times.regular expression [A+](r$egex: )?one$-plus $netregex: one-plus net[~A] denotes the set of all strings that are not in A.regular expression [~A](r$egex: )?n$egate $netregex: negate net[A - B] denotes the set of strings that are in A but not in B.regular expression [A - B](r$egex: )?min$us $netregex: minus net[A.l] denotes the lower language of the relation A.regular expression [A.l](r$egex: )?l$ower-side $netregex: lower-side net[@bin ] denotes the topmost network in the binary . Note that @bin only retrieves one network, whereas 'load stack' pushes onto the stack all the networks in the file.regular expression [@bin] (r$egex: )?loa$d $stackregex: load stack[A.i] denotes the relation that is the inverse of A; that is the upper and lower languages set of strings that belong to both A and B.regular expression [A.i]unary(r$egex: )?inv$ert $netregex: invert net[A & B] denotes the set of strings that belong to both A and B.regular expression [A & B](r$egex: )?int$ersect $netregex: intersect net[A .x. B] denotes the relation that maps every string of A to every string of B.regular expression [A .x. B](r$egex: )?cr$ossproduct $netregex: crossproduct net[A B] denotes the concatenation of all strings in A with all strings in B.regular expression [A B](r$egex: )?con$catenate $netregex: concatenate net[A .o. B] denotes the composition of the relations A and B .regular expression [A .o. B]binary(r$egex: )?com$pose $netregex: compose netWhen ON more information is printed. Default is ON.print messages(var$iable )?ver$bosevariable verboseWhen ON, the arcs of a network are sorted before executing a 'print net' command. Default is ON.sort the arcs before printing a network(var$iable )?sor$t-arcsvariable sort-arcsWhen ON, print commands show the position of flag diacritics. If the setting is OFF, flag diacritics (like epsilons) are not shown Default is OFF.show flag diacritics when printing(var$iable)?show-fl$agsvariable show-flagsWhen ON, the 'compile-replace' command requires token boundaries to be explicitly present in compiling a regular expression path. When OFF, the present token boundaries are preserved. Default is ON.retokenize regular expressions in 'compile-replace'(var$iable )?retok$enizevariable retokenizeWhen ON, 'define ;' treats instances of in as referring to what is being defined. 'define A [a | A b];' yields the left-recursive language [a b*]. The right-recursive definition 'define B [a B | b];' assigns to B the language [a* b]. 'define C [a C b | a b];' makes C equivalent to [a+ b+], a weak approximation of the context-free language C -> a C b, C -> a b. Default is OFF.allow self-reference in definitions(var$iable )?recursive-def$inevariable recursive-defineSeed of the random number generator. It cannot be inspected.seed of the random number generatorintegerNRO(var$iable )?ran$dom-seedvariable random-seedWhen ON literal instances of special characters are enclosed in double quotes: zero and question mark are printed as "0" and "?" to distinguish them from epsilon and the unknown symbol. Space, tab, and newline are printed as " ", "\t", and "\n", respectively, to distinguish them from each other. The affected commands are 'print words', 'print lower-words', and 'print upper-words'. Default is OFF.print special characters in double quotes(var$iable )?quote-$specialvariable quote-specialWhen ON, the application quits abruptly with an error if it is running a script and encounters a command that is incorrectly spelled or cannot be executed because of a missing file or some other error. Default is ON.quit scripts abruptly on any error(var$iable )?quit$-on-failvariable quit-on-failWhen ON, 'print word' and 'print random-word' insert a space between symbols. Default is OFF.insert a space between symbols in printing words(var$iable )?(pr$int)-spacevariable print-spaceWhen ON, the sigma is shown when a network is printed. Default is ON.show the sigma when a network is printed(var$iable )?(pr$int)-sigmavariable print-sigmaWhen ON,'apply up' and 'apply down' show both (UPPER and LOWER) sides of labels. Default is OFF.show both sides of labels in apply(var$iable )?(pr$int)-p$airsvariable print-pairsWhen ON, the constraints expressed as flag diacritics are taken into account by 'print [upper|lower]-words' and 'print random-[upper|lower]' commands. When OFF, flag diacritics are treated as ordinary symbols in listing the contents of a network. Default is ON.enforce flag diacritics(var$iable )?obey$-flagsvariable obey-flagsWhen ON, 'read regex' stores the regular expression on the property list of the result as the value of NETWORKNAME. Default is OFF.use regular expressions as network names(var$iable )?nam$e-netsvariable name-netsWhen ON, network operations minimize the result. Minimization includes epsilon removal and determinization. Default is ON.minimize the result of calculus operations(var$iable )?minima$lvariable minimalWhen ON, flag diacritics are treated in a special way composition treats flag diacritics as special kind of of epsilon symbols. Flag arcs are like epsilon arcs in that they are not matched against any symbol in the other network but, unlike true epsilons, they are retained in the resulting network. When OFF flag diacritics are treated as ordinary symbols. Default is OFF.treat flag diacritics as epsilons in composition(var$iable )?flag-is-eps$ilon|compose-flags-as-specialvariable flag-is-epsilonThe working directory.the working directoryfilenameFILENAME(var$iable )?dir$ectoryvariable directoryWhen the variable 'assert' and 'quit-on-fail' are both ON, the execution is terminated if the test result is 0 (NO). The default is OFF.quit if a test fails and quit-on-fail is ONON|OFFON_OR_OFF(var$iable )?as$sertvariable assertconcatenates the top network any number of times with itself and unions it with the language consisting of the empty string. If the network is defined as A, the result is equivalent to compiling the regular expression [A*].z$ero-plus n$et|ze$ro-pluszero-plus netstores the words in the top network, one per line. This format cannot be used for transducers or networks with multi-character labels. For such networks, use 'write spaced-text' instead. Use 'save stack' to store in a compact binary format. If no target file is specified, output will be sent to standard output (usually the terminal).|>target-filew$rite t$ext|wtwrite textStores the top network in a text format. This format is intended for transducers and networks with multi-character labels. Use 'read spaced-text' to read files in this format. Use 'write text' for simple networks with single-character labels. Use 'save stack' to store in a compact binary format. If no target file is specified, output will be sent to standard output (usually the terminal).writes the top net of the stack as text to a filew$rite s$paced-text|ws$paced-textwrite spaced-textprints the attribute-value pairs on the property list of the network. See also 'add properties', 'read properties'.prints the property list of the networkw$rite prop$erties|propswrite propertieswrites the network as Prolog-clauses. See also: 'read prolog'.writes the network as Prolog-clausesw$rite prol$og|wplwrite prologextracts the upper language from the network on the top of the stack. If the network is defined as A, the result is equivalent to compiling the regular expression [A.l]. 'upper-side net' has no effect on simple networks.extracts the upper side of the transducer on the top of the stackupp$er-side n$et|upper-sideupper-side netreplaces the stack with the union of all networks currently on the stack.makes union of finite-state networks in the stackuni$on n$et|uni$onunion netdisassociates the given symbol from the set that was bound to it by a previous 'list' definition. See also 'list', 'print lists'.disassociates a symbol or symbols from an earlier 'list' setunlistFlag diacritics (aka instructions) in symbol pairs are changed, for example, @U.CAP.Y@:a ==> 0:a @U.CAP.Y@ .change flag diacritics to identity pairstw$osided f$lag-diacritics|tfdtwosided flag-diacriticsunbinds the symbol that was bound by the 'define' command. 'undefine symbol1 symbol2 symbol3 ...' etc. undefines all the listed symbols. 'undefine ALL' removes all the definitions.unbind a symbol or symbols that were bound by 'define'list of symbolsund$efineundefinereverses the order of the networks on the the stack. NOTE: Use the command 'reverse net' to create the reverse language of the top net.reverses the order of the networks on the stacktu$rn s$tack|tu$rnturn stackreturns 1 (TRUE) if the upper side of the top level network contains the universal language.TRUE if the upper language is universal in the top network on the stackt$est upper-u$niversal|upper-u$niversal|tuutest upper-universalreturns 1 (TRUE) if the upper side of the top level network has no epsilon cycles.TRUE if no upper epsilon cycles in the top network on the stackt$est upper-b$ounded|upper-b$ounded|tubtest upper-boundedreturns 1 (TRUE) if the language of the i-th network is a sublanguage of the next (i+1-th) one on the stack. Starting at the topmost network (i=0). See also 'print stack' and 'turn stack'.TRUE if the language of a network is a sublanguage of the nextt$est subl$anguage|subl$anguage|tstest sublanguagereturns 1 (TRUE) if the languages of all networks on the stack have a non-empty intersection.TRUE if the languages overlap (of all networks on the stack)t$est o$verlap|ov$erlap|totest overlapreturns 1 (TRUE) if the top network on the stack is a null fsm.TRUE if the top network on the stack is a null fsmt$est nu$ll|tnutest nullreturns 1 (TRUE) if the top network on the stack is not a null fsm.TRUE if the top network on the stack is a non-null fsmt$est n$on-null|tnntest non-nullreturns 1 (TRUE) if the lower side of the top level network represents the universal language.TRUE if the lower language of the top network on the stack is universalt$est lower-u$niversal|lower-u$niversal|tlutest lower-universalreturns 1 (TRUE) if the lower side of the top level network has no epsilon cycles.TRUE if no lower epsilon cycles in the top network on the stackt$est lower-b$ounded|lower-b$ounded|tlbtest lower-boundedreturns 1 (TRUE) if all networks on the stack contain the same languageTRUE if the languages of the networks on the stack are the same.t$est e$quivalent|equ$ivalent|tetest equivalent'system command' executes the given operating system command(s), for instance, 'system ls'.execute a system commandsystem-commandPFILEsy$stemsystemreplaces the top network on the stack with a network that accepts every string that is a substring of some string in the language of the original network.collects all substrings of the top net of the stacksubs$tring n$et|subs$tringsubstring netreplaces the top network on the stack with a network derived by replacing every arc whose label contains the given symbol by an arc or arcs whose label instead contains one of the substitute symbols. If the list consists of the keyword NOTHING, all paths containing the given symbol are removed. The symbol and the substitutes must be single symbols, not symbol pairs. See also 'substitute label'.substitutes one or more symbols for the given symbolLIST-OF-SYMBOLS for SYMBOLsubs$titute sym$bolsubstitute symbolreplaces the top network on the stack with a network derived by replacing every arc with the given label by an arc or arcs, each labeled with one of the substitute labels. If the list consists of the keyword NOTHING, all paths containing the given label are removed. The label and the substitutes may be single symbols or a symbol pairs. See also 'substitute symbol'.substitutes one or more labels for the given labelLIST-OF-LABELS for LABELsubs$titute lab$elsubstitute labelreplaces the top network on the stack with a network derived by splicing in the network associated with the given name for each arc that contains the label. If the network is a transducer, LABEL must not occur in a symbol pair.replaces the given label by the network associated with the nameNAME for LABELsubs$titute def$inedsubstitute definedexecutes a file of XFST commands. For example, 'source xfst.script' executes the commands in xfst.script.execute a file of commandscommand filesou$rcesourceReorders the arcs of the top network in a canonical order.sort the transducerso$rt n$et|sor$tsort netreplaces the top network on the stack with a network that represents the language of the strings in the sigma alphabet of the original network. See also 'print sigma', 'label net'.replaces the top network with network of its sigma alphabetsig$ma n$etsigma netreplaces the stack with a single network that accepts every string formed by shuffling together (interdigitating) one string from each of the input languages. For instance, if Net1 accepts ab and Net2 accepts xy, then the shuffle of these nets will accept the following six strings: abxy axby axyb xaby xayb xyab.shuffle finite-state networks in the stackshu$ffle n$et|shu$ffleshuffle netshows the value of the variable. See also 'set'.show the value of the variablevariablesho$w var$iable|showshowsets a new value to the variable. The value may be an integer, ON or OFF, or a string. See variable for details. See also: 'show'.sets a new value to the variablevariable valueVARIABLEse$t var$iable|setsetstores all the networks on the stack into the given file in a binary format. Use 'load stack' to load the file.saves the stack of finite state automata to the filesa$ve st$ack|save|sssave stackstores the networks for all defined symbols into a binary file. Use 'load defined' to restore the definitions.saves the definitions to a filetarget-fileOUT_FILEsa$ve def$ined|savedsave definedPushes the top element of the stack to the bottom.pushes the top element of the stack to the bottomrot$ate st$ack|rot$aterotate stackreplaces the top net on the stack with one that accepts the reverse language.reverse the top net of the stackrev$erse n$et|rev$ersereverse netreads a net as text from a file or from the console. One word per line without empty lines. Space is taken literally. Example: New York Toronto San Francisco When reading from the console, use Control-D to terminate the input. See also 'write text', 'read spaced-text', 'write spaced-text'.r$ead t$ext|rtread textreads a transducer or a net with multicharacter symbols from a file or from the console. Separate paths with an empty line. Leave space between symbols. Zero is epsilon. % is space. Example: l e a v e +Verb +Past l e 0 f t a t t o r n e y 0 % g e n e r a l +Noun +Pl a t t o r n e y s % g e n e r a l When reading from the console, use Control-D to terminate the input. See also 'read text', 'write text', 'write spaced-text'.reads the net as text from a file | < source-filer$ead s$paced-text|rsread spaced-textcreates a network from a regular expression and and pushes it onto the stack. The file should contain one regular expression. If no filename is given the input is read from the console. The input expression must be terminated by a semicolon.transform a regular expression into a finite state network |];' When reading from the console, use Control-D to terminate the inputreads in Prolog-clauses and puts network(s) on the stackr$ead prol$og|rplread prologreads from a source file or from the console in the format of the lexc compiler, assembles all the sublexicons into a single network and pushes the result on the stack. When reading from the console use Control-D or END; to terminate the input.reads a lexicon file and puts the resulting network on the stack |source-filer$ead lexcread lexcExits the program.exit programquit|exit|bye|stop|au revoir|hyvsti|visz$lt|auf wiedersehen|hasta la vista|arrivederciquitremoves all paths leading to non-final states in the top network on the stack.prune the networkpru$ne n$et|pru$neprune netdisplays the paths in the top network or in the network assigned to the defined symbol. If a number is given, only that many paths are printed, otherwise every word is printed but not looping on any path more than once. The output can be directed to a file by adding a greater-than symbol, >, and a name of a target file to the end of the command. For example, 'print words > words.txt' If the network is a transducer, the output may contain symbol pairs. Otherwise, 'print lower-words', 'print words', and 'print upper-words' give the same output. See also the variables 'print-space', 'show-flags', and 'quote-special'.displays the words accepted by the top network |name|number|name numberpr$int w$ords|word$sprint wordsdisplays the words in the upper side language of the top network or in the network assigned to the defined symbol. If a number is given, only that many words are printed, otherwise every word is printed but not looping on any path more than once. The output can be directed to a file by adding a greater-than symbol, >, and a name of a target file to the end of the command. For example, 'print upper-words > upper-words.txt'. If the network is a simple network rather than a transducer, 'print lower-words', 'print words', and 'print upper-words' give the same output. See also the variables 'print-space', 'show-flags', and 'quote-special'.displays the words accepted by the upper side of the top network |name|number|name number| >target-filepr$int upp$er-words|upp$er-wordsprint upper-wordsdisplays the content of the stack.displays the content of the stack | >target-filepr$int sta$ck|sta$ckprint stackprints the size of the top network on the stack (by default) or the given definition.prints the size of the networkpr$int siz$e|siz$eprint sizetallies sigma frequencies by path in the top network on the stack. |upper|lower|>target-filepr$int sigma-w$ord-tally|swt|pswtprint sigma-word-tallytallies sigma arc frequencies in the top network on the stack.displays info about sigma frequencies of the top network on the stackpr$int sigma-t$ally|sigma-t$ally|sit$allyprint sigma-tallyprints the sigma alphabet of the top network on the stack (by default) or the given defined network. The sigma alphabet includes all the symbols that appear in the network, either as such or as a constituent of a symbol pair, and any symbols that have been excluded from the network by subtraction or complementation. See also 'print labels', 'sigma net'.pr$int s$igma|sig$maprint sigmagenerates 15 random words (by default) from the top network on the stack or any number specified in the command. If the network is a transducer, the output may contain symbol pairs. If the network is a simple automaton, rather than a transducer, 'print random-words' gives the same output as 'print random-lower' and 'print random-upper'. See also the variable 'print-space'.displays a selection of the words accepted by the top networkpr$int random-w$ords|random-w$ordsprint random-wordsgenerates 15 random words (by default) from the top network on the stack, or any number specified in the command. The words are from the upper side language of the net. If the network is a simple automaton, rather than a transducer, 'print random-upper' gives the same output as 'print random' and 'print random-lower'. See also the variable 'print-space'.displays a selection of the words accepted by the upper part of the top networkpr$int random-u$pper|random-u$pperprint random-uppergenerates 15 random words (by default) from the top network on the stack or any number specified in the command. The words are from the lower side language of the net. If the network is a simple automaton, rather than a transducer, 'print random-lower' gives the same output as 'print random' and 'print random-upper'. See also the variable 'print-space'.displays a selection of the words accepted by the lower part of the top network |number| >target-filepr$int random-l$ower|random-l$owerprint random-lowerprints a text representation of the top network on the stack (by default) or the given definition. The output is directed to a file by adding a greater-than symbol, >, and a name of a target file to the end of the command. See 'print-pairs'prints a text representation of the top network on the stack |symbol| >target-filepr$int n$et|netprint netprints the name of the top network on the stack. If the net is unnamed, the hex address of the net is printed instead. Use the command 'name net' to give a name to the top network.prints the name of the top network on the stackpr$int na$me|pna$meprint namedisplays the words in the lower side language of the top network or in the network assigned to the defined symbol. If a number is given, only that many words are printed, otherwise every word is printed but not looping on any path more than once. The output can be directed to a file by adding a greater-than symbol, >, and a name of a target file to the end of the command. For example, 'print lower-words > lower-words.txt'. If the network is a simple network rather than a transducer, 'print lower-words', 'print words', and 'print upper-words' give the same output. See also the variables 'print-space', 'show-flags', and 'quote-special'.displays the words accepted by the lower side of the top network |name|number|name number| >target-filepr$int lo$wer-words|low$er-wordsprint lower-wordsprints the length of the longest path in the top net.prints the size of the longest string in the netpr$int longest-string-size|longest-string-size|pslprint longest-string-sizeprints the longest path and its length of the top net.prints the longest string in the netpr$int lo$ngest-string|lon$gest-string|plsprint longest-stringprint all the symbols defined by a list command and the members of each set. See also 'list', 'unlist'.prints the symbols defined by a list (see list)pr$int list$sprint liststallies label frequencies in the top network on the stack.displays info about label frequencies of the top network on the stackpr$int label-t$ally|label-t$ally|ta$llyprint label-tallyprints the label alphabet of the top network on the stack (by default) or of the given defined network. The label alphabet includes all the symbols and symbol pairs that occur as arc labels in the network. See also 'print sigma', 'label net'.prints the alphabet of the network |symbol| >target-filepr$int la$bels|lab$elsprint labels'print flags' prints information about the top network on the stack.displays info about the top network on the stackpr$int fl$ags|flagsprint flagsdisplays info about the last opened binary file.displays info about the last opened (fst) filepr$int f$ile-info|file$-infoprint file-infoprints the content of the current directory in its entirety or the files that match the given pattern, such as '*.txt'.print the content of directory |filenames |[filenames] >target-filepr$int di$rectory|dir$ectoryprint directoryprints each defined symbol and the size of the network it stands for.print defined symbols (see define)pr$int de$fined|pdef$inedprint definedprints each alias and the command sequence it encodes.print the aliases and their values |>target-filepr$int a$liases|aliasesprint aliasesmakes a copy of the network named by a previous 'define' command and pushes it onto the stack. 'push defined SYMBOL' has the same effect as 'read regex SYMBOL ;'.push a defined network onto the stackpu$sh def$ined|pu$shpush definedremoves the top network on the stack.remove the top network on the stackpo$p s$tack|po$ppop stackconcatenates the top network any number of times with itself. If the network is defined as A, the result is equivalent to compiling the regular expression [A+].concatenate with itself the top net of the stackon$e-plus n$et|on$e-plusone-plus netreplaces the top network on the stack with a network that accepts all and only those strings rejected by the original. If the network is defined as A, the result is equivalent to compiling the regular expression [~A].calculate a negation of the top net of the stackneg$ate n$et|neg$atenegate netassigns the given name to the top network on the stack.gives a name to the top network on the stacksymbolna$me n$et|na$mename netreplaces the top two networks on the stack with a network containing all strings in the first network that are not in the second. If the two networks are defined as A and B, with A on top of the stack, the result is equivalent to compiling the regular expression [A - B].return net that accepts the strings of the top net on the stack minus the strings of the second netminu$s n$et|minu$sminus netreplaces the top network on the stack with an equivalent network that has a minimal number of states.minimize the number of states in the networkmini$mize n$et|mini$mizeminimize netextracts the lower language of the top network on the stack. If the network is defined as A, the result is equivalent to compiling the regular expression [A.l]. 'lower-side net' has no effect on simple networks. extract the lower side of the transducer on the top of the stacklow$er-side n$et|lower-sidelower-side netreads the networks in the given file, and pushes them onto the the stack. The file must be in the binary format, as produced by the 'save stack' command. If the file only contains a single network, it can also be loaded with the command 'read regex [@bin ];'.reads finite state automata from the file'. If the regular expression is omitted, i.e. if the command is 'define ', the symbol is bound to the top net on the stack. The net is removed from the stack. See also: 'load defined', 'save defined', 'print defined', 'read regex', 'undefine', and 'recursive-define'.bind the given symbol to a network compiled from a regular expressionsymbol|symbol regular expressiondef$inedefinereturns the crossproduct of the first two networks on the stack. They must not be transducers. If the stack consists of two networks, defined as A and B, with A on top of the stack, the result is equivalent to compiling the regular expression [A .x. B].return the crossproduct of the top two automata on the stackcr$ossproduct n$et|cross$productcrossproduct netreplaces the stack with the concatenation of all networks currently on the stack. If the consists of two networks, defined as A and B, with A on top of the stack, the result is equivalent to compiling the regular expression [A B]. In regular expressions, concatenation is indicated simply by whitespace.concatenate the finite-state networks in the stackcon$catenate n$et|concat$enateconcatenate netreplaces the stack with the composition of all networks currently on the stack. If the stack consists of two networks, defined as A and B, with A on top of the stack, the result is equivalent to compiling the regular expression [A .o. B].compose the finite-state networks in the stackcom$pose n$et|compo$secompose netextends the top network until it has a transition for every symbol in sigma in every state. All new transitions lead to a failure state, thus the language of the network is preserved.Complete is defined only for simple networks (arity = 1), not for transducers.complete the simple automatoncompl$ete n$et|compl$etecomplete netcompiles every regular expression on the upper side of the network and replaces the original expression by the result of the compilation. See also 'retokenize', 'compile-replace lower'.compile-re$place u$pper|com-rep u$percompile-replace uppercompiles every regular expression on the lower side of the network and replaces the original expression by the result of the compilation. See also 'retokenize', 'compile-replace upper'.compile and replace regular expressions in the netcompile-re$place l$ower|com-rep l$owercompile-replace lowerall symbols that have the same distribution as the unknown symbol are eliminated from the alphabet and the corresponding redundant arcs are removed from the network.eliminate redundant symbols and arcscomp$act s$igmacompact sigmaRemoves all networks on the stack.removes all networks on the stackcl$ear s$tack|clearclear stackmerges X:0 0:Y and 0:Y X:0 sequences to X:Y, if possiblemerges X:0 0:Y sequences to X:Y, if possiblecl$eanup n$et|cleanupcleanup net'apropos text' prints brief information about the commands relating to the given text. If you need further information about a command, use the command 'help command-name'.print brief help information about the relating commandstextREAD_LINEapr$oposaproposSimulates the composition of the input string with the upper side of the top network on the stack and extracts the result from the lower side. If the command `apply down' is followed by a carriage return, the program prompts the user with apply>, prints the result and gives a prompt for a new input. Control-D exits from this mode. You can also input END; to exit. See also 'print-pairs', 'print-space' 'show-flags' for output options.applies the input line to the upper side of the top networkapp$ly do$wn|downapply downSimulates the composition of the input string with the lower side of the top network on the stack and extracts the result from the upper side. If the command `apply up' is followed by a carriage return,the program prompts the user with apply>, prints the result and gives a prompt for a new input. Control-D exits from this mode. You can also input END; to exit. See also 'print-pairs', 'print-space' 'show-flags' for output options.applies the input line to the lower side of the top network |line| ' defines as a shorthand for the given sequence of XFST commands. For instance, the new command 'ls' can be created in the following way: alias ls print directory Alias may contain several commands. A new command 'lexr', for reading a lexicon, can be created in the following way: fst[0]: alias lexr alias> load lexicon.fst alias> print properties alias> END; A multi-command alias may also be defined on one line as follows: alias lexr load lexicon.fst; print properties See also: 'print aliases'.define a word to be a shorthand notation |name|name command sequence|ATOMIali$asaliasreads attribute-value pairs from a text file or from the console and adds them to the property list of the top network on the stack. Each line in the source file must contain one attribute-value pair. For example, COPYRIGHT: "Xerox Corporation" DATE: "June 10, 1997" VERSION: 9 The attributes, each terminated by a colon, must be strings (upper case recommended). The values may be strings or integers. String values must be enclosed in double quotes: "9" and 9 are considered as different values. If an attribute to be added already exists on the property list of the network, 'add properties' will reset it to a new value. When reading from the console, use Control-D to terminate the input. See also: 'read properties', 'write-properties'.adds attribute-value pairs to the network's property list |?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~              $ ($$cYeOU(a$$giwxyz{srtuvPRQXZl$$]^mbkSTW[_dnopq($(((6662(((( "#&'%( .+*!)N\`V444/5((((01(,((~GHI(JF :;=<LK9@?EADM3(((}| 78 >CfhBjwtP;U(,*-.uvwxyz{|}~C"E 4E 4EEJ  EEEKKK9 C L4L4KAn [<<<KKK EXKK%рр (\!Qр <<<<3u\Ӏ,B:D|a# )3r24  ST] !"<=:::!"!" VOW_\xyQN +b  R   $^%&'/c0)1[56789`!">?@A!"BCDEGFHIJKLMopsq^XYZdefghijklmntuv  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrs !,-/01236789:;<=>?@ABCDHIJKLMNOPQRSTcde.g  p % |#%hj.045 45&$`#% ! $G U,)* & 3_VWX#)*`abf)*$ikqlmno$&]^vwxy"+!#%&2YZ[  |*s42s!)*)*\]b_b ;<=>?@ABGHXdef'(,-./01234569:<?@ABCDEFGHIJKLMNOPQRSTVXYZ\]^abcdefghijklmnopqrstuvwxyz{|}~<?@ABCEHITVYZ\]^cdefghijklmnopquvwxyz{|}~parser stack overflowDo you really want to exit? wfst:open_pipeIllegal or missing pipe. C-fsm error: cannot intern symbol in function intern_symbol()C-fsm error: cannot intern symbol in function intern_unicode()C-fsm error: cannot intern symbol in function make_fstlabel()stdinNo files have been loaded or saved yet.bothapply down> apply up> compose-apply up> compose-apply down> Cannot define %s. helpNo description for %s. Type "help" to list all commands or try "apropos %s" to find appropriate commands. thattoo many arguments, ignoring: %s parse errorPlease, check the parameters: %s Command not executed command '%s' not found ONOFF%s = %d %s = %s *** Error on line %d in file '%s'. *** Error on line %d in the script Aborting the script because quit-on-fail is ON.Error - command not executed *** Input contains %d or more errors pwdls -F wbOpening '%s' Closing '%s'  ""X##$$BCGR+SSY\\deffg~~='**-//!!10<<.ADDEE?HHJJ5568LLM97V^TUWZ[]``::bhkrvwzz(&%;GIIQQlmpxxyy{{||}} )-cFKat >@Q_jq,u234NOPno ais  !"#$%&$'()$*+,-.$/0$123 4 56789:;<=$>?@ABCDEFGHIJKLMNOPQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQRQQSQQQQQQQQQQQQQQQQQQQQQQQQQQQ     #,B,zohjfge^fmt`8'037<qmdcg$q>{_222:222)2]22P>T"Z/@e XBNa>.SrC1(/!8;>Agmj2222Oy22K|(122222$2222212 BWNCPGeo-Zu~&S2_YotwybQubQONVGW <wNI]Ay Q>7L;PS|V<5;?mqIux:3B2,2+y%!NU6|Hw22*2:CK`d2gj2222+DaHF>@e*Hq@LnB2n2*124 2th2     (` 3P7 =) H R U2 X _ m p wb { 2 \2 2 2  2 ,  2_ ! ) / 2r 6 K N T22 W d q y M 2  2  2 2L 22   6Z  2 ! . 6 92 ?2 C2g G2 ` h u{@g|z }typ _ Qk {2 z2 ^2 Hur mAt#H2 L2    # - C ] ` g w }     1  k (2 0 S.a2m V2"2 (]2 QQ`2 U [5R *e ph2 v y2 |2  Q V2> EU :2F X2\ D2m  2 2 23269<C2S[X\|_hGt0(*220$2"X222 222/222=22!*26:2?KFO42222d2p2y022V2d222A222#)i.2M[6^ siwGP53}9 '* K > v2  >  .2G2?2JOX iofm222 2~   #2,2: %AH2 5P2 ?W` Oglpu22txs2 juo 9+5eC MP DYSWbh 9mO^2 ~ qt }2OHK N < k#+1 j@IM~^chl8182215Y2O!    2 v2p2 2  2!?2CF%M2PT&[j^  s2vy  L2 D U 2 2 0 t P 2 2  2 03<JTW_bn2wz2 222  & +06;FKTQ[2`puy22}-42;sB>IY`d enuh|[ '2^M 59NRANRJ2JE[ sg v }  # ~8v < pZ e2 W #0:4838 w<e2?dU KTW]c xry# '  X*&14?JMblo{22  #-=BHR]bgr|G * 2 c 2%+5; E2JZ `cj y D   222 J 6 f   (-7=CF NS] Mmr{ 2  u*:0EIQZbjorx 3 j W   O ! ( - 6 9 = n E ] R N V _ g w = 2   d m S > 22  B ! ! !! !%!*!-!6 !:!D!P j!S!_!n!~ !!!!!! %!!!  a!!!!2!2!2!"""""$"2"'2"22"- ">"I"W"^"b"g"|""" 6"""""" " ""22""" "#" # <#### K #4#8#?#Y#r##d I (2#{2#~# #### s## , e########$ $$$ $"$1$;$H$L$R$V$k$r$v$$$$$$ +$$$$$$$$$% %%%% a%%%)%0%6 J%E%L L $2%S%Z%] %y29 %%% %%%%% %% %%& & W&&&"&. &9&D&J&N&S&Y&i&p&s&w&~&&&&&&&&&&&&&'''''' '$'; '>'A'V'J'_'n'u'x'{ '~'''t '' ' ''' Z '(z((.((8(F(P(]((tU(((k*('(( ((,(((((((())))!)()7)>)M)/)F)T)W)\)q)v)y)})))))))2))){)-) )))** *:**+*. *4*;*I*P*V*Z*e*a*|****************+G+ + +++"+*+7+@+F+L+O+V+\+k+d+q+|+t++++2++++ 2+++++++,,,i,!,),2,?,C7,K,T,X,\,i,d,q,y,,aP:,rqh^ e2,----)-6-C-P-]-j-w----------... .,.7.B.M.X.c.o.|...........// //'/3/>/I/T/_/j/u/////////////00 00#000=0J0W0d0q0~000000000011 11!1,171C1K1Q1W1]1h1u11111111112222+282E2R2_2l2y222  !%'                                                                    ! " ! # $ % & ' ( ( ( ) ( ( & * * * + * * , - * , . . / 0 / / / 1 2 2 3 4 3 3 3 5 6 6 7 8 7 7 7 9 : : : : ; < < ; ; ; = > > = = = ? @ @ A A B B C , / 1 3 5 7 9 : < < > > = ? ? C , 1 5 9 : < > = ? C , 1 5 9 : = C , 1 5 9 : = C , 1 5 9 : C , 1 5 9 : D E F G H C I J K , , L L M N : : O H O O C P Q P R R P P S P C C C C P Q , , T U T T T T T V W T , , , , , T U : : : : P P T T WAABAAB=HHHHHHJJKLCMCDHDHNJJKOLMRRKhhSQTNAA>ON RRKUSTEEDHNHPUABHIABPRCPC45NEOJPAABKVVffAABCLWMDEgCEmDTnXYZ[\]^_W`abcdefghijkY\lEAAB7AABhhEAABUAABCCDDCCXDFDGff]mnopZ[[qrstuvwgxAAEAABEAABAABEAABEAABCDDDCDCDDyz{|}~EEAABEECD .  yz!{|}~"/^^^E@AAB@@@'@`@@@N^/C0@)*2%p@@@307q^}~(O@E@@@@@AAB@@@@}@@@^^^DC@abk&^ E+89:;<=@@@,-x}l@E@@@@@AAB@@@^@@@@z{C@@_Yvw\ y!ff"#@@@$ T%&'()*PQR@E@@@@@AAB@@@}@@@@^^^C@@de^+hh,-^^^./0@@@1Q23`^}i@E@@@@@AAB@@@^@@@@jjjC@@lRj7^jjjjjjjjjsss@@@mnQpqjljujsr@@E@@@@@AAB@@@j@@@@VWXC@@jjjsA@@@@E@@@@@AAB@@@@@@@@@@@C@@@@E@@AAB@@@@@@@@@@C@@@@@@@E@AAB sssssssssCkvwWuDsyzss{}~'}J%Esss*!W'(}###V#7Z"{   )W # N[ .n oNT=:xNOfQ_\%\Z]*$$$111666T>>>$16UN>@A@8lY9:;@<Y=HHHIJISSS7$?16HIS>\\\^^^`a`cccB|}|Z\[@^K` c|LTMHI S ]^^^D^^^Eb\~d^``^c^|"^^^^^^de^7^^^^^^^^^^d^^^d^^^^^jjj`^^l^j jjjjjjT^jjj^j^jjjjpqjjjjkpj^j /#jjjjjjjjssssssS'pljujjsxsj@sssjssssssjssss!jyz$ys0'ss.sss(j}~j!8sA(syssss}~c}TUu}~ss}s}s}s/v"9)s}dVs}}`H}IoJrx\.Q*Naptns xf89:;<=Y\`[ QN Tu#'.;;>cU\-8$(/U@@@<]   ^?Z@{d 99{: |V; @|` l$%$ '''$H*I'o#1---   Y&1a2-3<=< 4r567Y89$<???+'QpNEEE.?###$$$EEE%-E #>x$sELMLOPO<RRRXYXB;LFO\]\?RHXKTG_`_vE\bbb#U$QNE_dddghgbjjjlllpppLdO^g666RjXlpc a \6@@@ttt e_/>>>bm@xtikQdg>|||j}}}lpq~~~ttt6|};ru~tv z@_0twb>IJIg|I> }//\\\~<t^^^a\\\\````a`^\ \`.d`Iccc?Yrc\^>\``?|}||||~cQt||x\^^^~\^||./Y^^^^^^}^^^^^^^^^d^\^7^^^W}^^^^^^^^^x jjj`^^x^jjj^jjjjvaBjjjjQ.^jjjjpXjjjjjjj!Yjx^^jyYjjjjjqssssss[j~6ljjsksjsss`jsssgjsjsssyrsxssssssssssjjsss/.uss}~xfs}s\sQssY/sha}SKI @@@N  @ 45   *** *@121 454%)1 4*+,-$%$30>>>$/716--->   4BBB -''' ;B}___:=<k'v?T$ZwXS_@yRQQQ>L<=<JCFKGA8L-QEEE <B4.N###,'E+(O$$$EEE$_LML#W R$EOPOL1i1Q[mnm<\]\\O_`_1dddEm\bbbggg_#d]b_$bEgjLghgjjjeqtlllOHHH1gMjmz{z\KvlGuF_H666d@@@EztttbDCgw6@>>>tyBA?xgj>IIIkl}H|IJIc zI|||7~6I~@t|kjugf>da\\\\^^^[\\\I WVSN\QQQI^\('|!```vQ `a`wx y``ccc\^c\QJ``c*khgf^ZYX|||TPM&|VSP|ll^^^yxs^SIDC5;,^^^ }~jjj`jjj^}jl^jssssssSSSussS^}j   utjsroji   hsgfsezZYSU C54   z  &&&@@@      &@  +++"u$#+%)V*S000&@P222G FE40 D,CBvA2000@w.x?y+6888 0/112138:4545061HH$$$24$%$9@$@@70$@=8>>>---1A   B4@BBB>-D $C>>>$BE>&&&GFOOO---&H>___-O I-JMB'''_QQQL>K'QYYY<<<P<=<&RTQEEEYO<-<###U_E$$$X#'EEEQZ$LLLLMLOPO_EY<`L<LO111Eiii\\\\]\#1nnni$b\\e_`_EncbbbpLhL_OgggjjjlblllHHHmo1gjiz{z\l\H666@@@ntttzq6_@stbr>>>tgjzlH>{|}IIIz|||6G@tI|>\\\^^^QQQI\|^\\\Q````a`ccc\``c\<^Q\``c|||||^^^jjjsss`l^ujs}~}SSS   S^js   } S  @@@@      +++  +000@2220 2 888+121811110444$$$21$%$4$$81>>>   1BBB>4>>>$ B$&&&>&---___> B- _ddd >lll &dQQQ l<<<QRRR-<_RdEEE###lLLLEQ#LOPO<LMLOOOROiiiL111OXXXiE1#\\\LX\]\ nnnggg\bbbO\jjj"!LngOb#HHHjizzz1z1zX&H666%z@@@z\'\6tttn@g)b*HHHj-tIII|||2HHzI|z>>>663@57>9t:H<I|=YYY\\\\\\`a`@>?Y\\A`BCcccDMMMEFcGHMIY\\`UUUOKNWcUMPQTYVU[]^`lllnnnpppfcl^^^n}~pe`^hi}vmyjjjqossslljnsBBBupws^xB}   j s  B   @@@   @   +++  +000222>>>@02 >888 +}}}~~~8111}~121444012$$$>14$8>>>}~   BBB1>>>>1 4B$>&&&&> B---___ddd>lll-_d&lQQQ<<<QRRR<-_dREEEl###LLLLMLOOOE#iiiLQLO!<111iXXXmmmR1\\\Xm\]\Ennn#\bbbLLO\bbbn%ibHHHzzzbz1z1tttXHzm@@@z\tHHHIII\@|||nbHIb|Hzzt@HI|YYY\\\\\\`a`Y\\`MMMZMUUUY\\`UMUlllnnnpppln^^^pjjj`sss^l}~jus}lnp^js}@@@@000>>>0>    }}}@,~~~}111121~0444>11>>>4   BBB>} >>>B~>114>lll B___lQQQ> _Q!###%%%$'''#l)))%OOOiii'_XXX"Q)mmmOibbbX#m&b#HHH(111%,*+-'.H333)1zzzOi555X/3z1zmz@@@05btttz2@HHH4Ht16HIII|||38z95I|z<@=0tYYYH@\\\\\\`a`YFI\|\`CANNNOOODENYOGH\\M`UUUJLUlllNPOnnn^^^lpppQ`nR^jjjpUUbl]TjsssV^Zcul}~snnnn_^d}plllnejlsio}@@@pnm+z+@l>>>r+sw>tu}}}x~~~@}BBB>>>{~+B>>|}}~###B>%%%#'''%)))OOOiii'HHH)OXXXimmmHbbb111#X555m333%b1jz1z5'3@@@)Ozi}}}H@~~~tttXHHHm}b~1t5H3|||z@|FYYY}\\\~t\\\HY`a`\\`|UUUY\U\`lllnnnppplnUp^^^jjjsss`l^fjufsf}~lnp}lllnnn^jsln}@@@>>>@ln>88}}}8~~~}>>>@~>>>>>8bbb}>ppp~b>p###%%%>#%'''b)))XXXp'mmm)Xbbbm333HHH#%b1113H555@@@'1}}})~~~X5HHH@m}~Hb|||3H1|5@}~HYYY\\\\\\Y|\UUU\UlllnnnY\\ln U     ln       !"# % &)*+,./'nnn,llln( l >>>'0,23>}}}n~~~l7}8~>>>:<=>>%%%''')))}>bbb%~'###)@Ab?#B>pppC%%%DEpF'''G%'%)f)))b'JXXX#mmm)bbbHHHHXmIpbKH111%L555@@@'}}}M1N5)@~~~HHH}Xm|||b~HHO|1PQ5\\\@S}YYYVTR\\\\~HUY\\\|W\UUUX\}~UYnnn\}T}~efbYZn]_\}^gef\Ug}nnnn}nghig!"n)*!"!"!"!"jk!")*lllmllllnnnln}}}~~~o}lp~>>>ql%%%n>sxwu%''')))y}bbb~'%%%z)pppb{>%'''|p}###%)))mmm'~111#')m)1@@@b}}}~~~%HHHp@}~H'|||#)m\\\1|\\\1\\\\@\}~H\UUUnnn~|Un~}\\}\Ullln}lllnnnl}ln}}}~~~>>>}~l>ln%%%''')))ppp%bbb'}}}})p~b>}~~~~|||%')|pb\\\}\\\UUU\\~Unnnlll|nnnnln~~~\\>>>U~>%%%'''n)))lbbbn%')pppb}}}~~~~p>}|||~%'|)DbK\\\pnnn}\~lllnnnn~~~|%%%ln~%''')))\ppp~~~'n)p~|||ln~\\\%|nnn\'lll)nnnnp~lpppn~~~|p|||~\nnn|npppn|||lnpEM|p~ppp|pnCp|5p@@@@@@@@@@@@@FFFFFFFFFFFFFGGGGGGGGGGGGGIIIIIIIIIIIIIQQQQQQQQQQQQQ_______ccccccckkkkkkkoooooootttttttxxxxxxx|||||||||||||_______ccccccckkkkkkkoooooootttttttxxxxxxx|||||||||||||ccccccc_______oooooookkkkkkkxxxxxxxttttttt||||||||||||                                       $$$$$$$$$$$$$-------------ddddddddddddd?lAAII3OO4JJ {3 O)))4l== b b X Z)ZXZ)XX X[ [v[=v9]]{^^ >>i=iy)y^9w w 9 c9c>9 x99 x 9G}QQG>QQ  : ###}$$$ ## #$$$#RR/$RR/ : :***  +++,,,#---$*...*+,:+-,.-:UU.U:ULL:L::L`:L;*Ud+d,dd-ddd.WWWL\\;;\`$\\W;`\`;L;;;;; <!3W$$"<<"MMM&<M MI<&<< M<<kI<!3.F MTTT.#TkkTkkk=#fSST#SOSSFPPSff=[TNNff]ffgOgffggSgUgggggh444[]Ugghhhhhhhhhhh~~7R777RR!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%''''''lX'''''J''''''l'X&'XXBJ'Y&[)BYN[).v44OtawNykzk.v{tOwtazy{%      Z  *%%%))) %+++% )%  + ,,, 000*Z***,**0111222555)+%)125+;;;<<<>>>???,QQQ;,<20>?TTTQYYYff25212T5Y\\\;___2```2>;Q?\<_>`_?`QTYaaabbbTWWWYaabba\bcccWdddeee\ccv_cdd`eedteiiiWkkkWiWWWWiWakWbkWW:lllimmmclnnndlemmooom nnpppnooio pp/kpqqqrrrtttuuu:qqnrqtlrutaum@vvv nrwwwxxxovvyyyv pwwxxw/'xyyyzzzq|||r!%t@(uzz{{{z}}}P|={{v`}w[x'{y;!%(z|P={}M44]4`hAM]91`hAAAAAA ;"#'. ;25c"8#'.U2ZZ5nc8-U`n -o      { `     r     {o i  br   !!!((( ***!(i+++v*,,,i b+---///,000222555- */777!0(25v,+*7888::: -+z;;;???,28:/0-;/?CCC0DDD2|57EEEFFF7CDGGG;8:E|F: ?8z:G;KKK;?LLLMMMPPPKqQQQTTTCL>DM0PWWWEQ;FTXXXZZZG]]]W___bbbXZPL]K_TbqQLdddMA>PyfffQkXTW0]diii_Wfooo1XjZbi]sss_objdduuuAfsxxx}}}~~~idugofxa}~1aiodu\sjs~x}uugYx}~aSt\\KIut~~~z W  z  6W  6Xl7lBX[7`B[`r   ffr     }rk    _"""XSR###  LJ84"ccc#&&&)))***+++.,,,&/,)+*"+ ...,000 111333".555#0)13777&+*5/,&)/*7+./999,>>>BBB135305.9FFF0>1B~3y7GGGw5Fvp7HHHKKKk7NNNGa>SN9H4KQQQ(NVVV9F[[[>^^^BG!Qaaa VeeeF[eee^cccfffa))Ge) H)NKHcKfVNiiikkkQ^ammmQnnnVik[ooo^fmcanqqqerrrouuucfwwwkqvvvrzzzzunmwzivzkzzmqnoowurqrvulkw{vzgfzd^YXSPOMI{{{{{yxsWUTSJIDCA;86 ****rqp''nm'jhgeYVUR=<93'"ZVSMLKJHEDCBA@986-('                              !!! u$$$!%%%~ |&&&$)))%z(((uts)& r!q)p+++uo(,,,nu$um---u!j+///ea,_000%&$-Y333%(/0666)D0?&+777)321999(6:::0;;;/7<<</+9-,:;-<3/===0???@@@39AAA:67=CCC?7@EEE<A9;DDD:C;HHH<E=FFFDGGGAH?JJJFKKK=GC?NNN@JADKEHCLLLNRRREGDFLHRTTTVVVFJWWWGKNJ[[[TJVKW\\\NN[]]]LR\L___RV]aaabbbeee[_TV\aWbehhh[jjjpppqqq\]hsssj]apqettt_sbuuutahbtevvvwwwpuxxxyyyqshvwj|||pxqy}}}~~~s|u}t~wuvyvw|xy|}~|}~+++++            """###$$$"%%%#$)))***%,,,)*...,"#$."///111#%$333555/%)1*777)3*5,666999,.7:::.===691:<<<=/@@@13???AAA3<65BBB7@:?7ACCC9B6:9::DDD<:C==EEE?FFFDGGG<HHHE@AF?IIIAGJJJHBLLLKKKIMMMCJPPPLDFKGEDHMQQQPRRRETTTFIJGQHRLKTUUUMIVVVJPWWWLKUXXXQMVRPWZZZ[[[TX\\\Q]]]RZUT[V\W]^^^XU___```VbbbW^[_X`ZbeeeZ][ccc\ddd]^efffgggc`hhhdjjj^f_gb_h`lllbjmmmcdooorrrlqqqemssshgcordqjtttfsgxxxh{{{jmt|||lx}}}{lom|o}rqqtsx{tx{|}},,,,,                                 !!! """!###$$$"%%%# $&&&'''%(((! &)))#'"!(***---$)222"555#*-$333(2666%5777999&3:::'6<<<(79:===):*-<2*3-6=52???5@@@793<6?BBB7@9CCCDDD:EEE<BFFFGGGC=DHHHEIIIFGH@KKKH?INNN@BOOOKCEPPPBNGQQQOCDFTTTEPVVVFQGTIHTWWWIVKYYYZZZPK[[[WONYZO]]][QP^^^QV]```T---ZV^-Y-W[`cccWeeeYZfffhhh[ciiiemmmooof]hqqqisss^movvv`qwwwsfvxxxvwyyycwvoemxwxfhyxiymoqqsvwxy                       !!!"""###!"$$$#&&&$(((&"***+++,,,(!#000!*"+---,...#$0///222$-666&.444&(/2,8886*(40999*+.8,-:::09;;;/<<<-2===.:64/;2<6=>>>49???@@@AAA8CCC>DDD?9:@A;<CEEE:DFFF;=<GGG=EHHHF>@?JJJGAD>HLLL?@CAJMMMCEDLPPPQQQGMFERRRFPTTTQVVVGUUUHRTZZZVJ\\\PU]]]LQM^^^Z___M\R]TP^Q_bbbcccRdddTbUVcbbcUdc\^ddZeee\]]iii^_eegggggigmmmooobpppcghhhhdhmhorrrpssshitttuuuerwwwsxxxitou{{{wgxm|||mros{p~~~ht|}}}urs~wt}uwx{{|}|~}          3333  !!!!!3     ! """" ####"#$$$!$$#%%%%$%"000%(((#( (0$&&&&"&(&%...#.&.////$//.222%/0&44402555.(77748885&:::<<<7===.8>>>:/<2???=@@@24>AAABBB5?4@DDD5AB8=7<CCC8:DEEE:<FFF>=CGGG>EKKKAF?HHH@GBIIIAKBLLLCHDJJJDIMMMNNNLEOOOCJFGEMNHFOPPPIGQQQRRRKSSSTTTHPWWWQIRUUUSJLTVVVJWXXXMUNYYYOVQZZZRXST]]]YWPZQURS]T^^^___WbbbVUddddX^V_bXYggggdY]hhiiZhihig]jjhij_jkkmmmkkb^j_ooobkhmidpppqqqosssjguuupkqhiswwwuxxxjyyyzzzwkm|||x{{{yozqup|p{q}}}sw~~~uy}w~xyz|z{|{}~}~                                                                                                                                                                                                                                                ! ! ! ! ! ! ! ! ! ! ! ! ! " " " " " " " " " " " " # # # # # # # # # # # # # $ $ $ $ $ $ $ $ $ $ $ $ $ % % % % % % % % % % % % % & & & & & & & & & & ' ' ' ' ' ' ' ' ' ' ' ' ( ( ( ( ( ( ( ( ( ( ( ( ) ) ) ) ) ) ) ) ) ) ) ) ) * * * * * * * * * * * * + + + + + + + + + + + + + , , , , , , , , , , , - - - - - - - - - - - - . . . . . . . / / / / / / / 0 0 0 0 0 0 0 1 1 1 1 1 1 1 2 2 2 2 2 2 2 3 3 3 3 3 3 3 4 4 4 4 4 4 4 5 5 5 5 5 5 5 6 6 6 6 6 6 6 7 7 7 7 7 7 7 8 8 8 8 8 8 8 9 9 9 9 9 9 9 : : : : : : : : : : : : ; ; ; ; < < < < = = = > > > ? ? ? ? ? ? ? ? ? ? ? ? ? @ @ @ @ @ @ @ @ @ @ @ @ @ A A A A A A A A A A A A A B B B B B B B B B B B B B C C C C C C C C C C D D D D D D D D D D D D D E E E E E E E E E E E E E F F F F F F F F F F F F F G G G G G G G G G G G G G H H H H H H H H H H H H H I I I I I I I I I I I I I J J J J J J J J J J J J J K K K K K K K K K K K K K L L L L L L L L L L L L L M M M M M M M M M M M M M N N N N N N N N N N N N N O O O O O O O O O O O O O P P P P P P P P P P P P Q Q Q Q Q Q Q Q Q Q Q Q Q R R R R R R R R R R R R S S S S S S S S S S S S S T T T T T T T T T T T T U U U U U U U U U U U U U V V V V V V V V V V V V V W W W W W W W W W W W W Please answer yes or no> Please answer (yes/no/info)> flex scanner jammedfatal flex scanner internal error--no action foundfatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowinput in flex scanner failedflex scanner push-back overflowout of dynamic memory in yy_create_buffer()out of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()%s *** INTERNAL ERROR. THE READER IS CONFUSED. PLEASE REPORT THIS!!! too big string to clean, ignoring: %d rOpening file %s... The file %s is probably in a binary format. Closing file %s... %s:%u: failed assertion auto-interface.lexInterface flex: inconsistent internal yy_current_buffer and size: %d < %d not true. Interface flex: inconsistent internal values. *** Bad character in atomnum: %c *** Error: "%s" is too large for an octal number. Max is "\377". *** Error: Expecting an initial " in %s *** Error: Expecting a final " in "%s Sorry, I don't know if your network is unambiguous on the %s side. upperlowerFlag attribute '%s' does not occur in the network. ERROR: %s all0, (0=NO,1=YES) 1, (0=NO,1=YES) compiler error: in iy_test_2_op() %s bimachine cannot be applied %s. A downwardupwardsAn upnwarddownwardsThe two halves of %s bimachine should be on the stack in the opposite order: %s, %s. Unsupported network formatIY_APPLY_AND_PRINTStandard apply routine does not work on vectorized nets. Unvectorizing...*** When the variables 'delete-patterns' and 'extract-patterns' are both ON 'apply patterns up' and 'apply patterns down' produce no output. unless 'count-patterns' is ON. Aborting... Sorry. This function has not yet been implemented for reduced networks. Sorry. This function has not been implemented for bimachines. %s%s -rCannot open %s No net found. %s Number of paths = %lu 1 (1 = TRUE, 0 = FALSE) 0 (1 = TRUE, 0 = FALSE) Can't print a net having this format... This network is too large to be displayed in text format by xfst. You need to license a professional version of this program to print it. Sigma: Can't check for epsilon cycles in a compacted network. Longest non-looping upper string has %d character(s). Longest non-looping lower string has %d character(s). Can't process this network format. You need to license a professional version of this program to see more. The number of random paths requested was too large for xfst. Word:, %ld%s Use ^D to terminate input. Lexc definitions%s:%u: failed assertion iy-fs-ops.cCannot lopen '%s' Reading from '%s' One word per line. Space between symbols. A pair of adjacent lines is a transducer path. Leave a blank line between paths. One word per line. Type a network description in lexc format. Type one or more networks in prolog format. Closing '%s' No net. This net is circular. Cannot save it as text. Sorry. This network is too large to be saved as a text file by xfst. You need to license a professional version of this program. Net is a transducer with multi-character labels. . Net contains multi-character labels. Use 'write spaced-text' instead. Cannot reorder arcs when arcs are shared. stdinAborting +------------------------------+ | XFST NETWORK PROPERTY EDITOR | Prop-edit (0-4) [exit]:%%%% input out of range (0-4) XFST: Name for the top network ( = Cancel):Cancelled. Symbol '' names a transducer and '' occurs in a symbol pair. Cannot substitute. ' is undefined. No occurrences of %s '' in the network. symbollabeldefined %s: %s has not been defined no definitions Aliasesalias %s %s No aliases. Too deep recursion on aliases. no list symbols ON_OR_OFFNROFILENAMELICENSE_TYPE%s:%u: failed assertion iy-help.cONOFF%s COMMAND CLASS: %s , , variable%s == %s regex: %s (%s) usage| (alias: ): %s %s %s Current value is %s.%d.pwd %s No description for %s. Type "help" to list all commands or try "apropos %s" to find appropriate commands. that commandvariablesvariable %s : %s : %s %s : %s : %s %s : %s : %s %s : %d : %s %s %d : %s %s : %d : %s %s : %s : %s %s : %s : %s %s : %s %s : %s Functions%s) $1%s %s:%u: failed assertion com-rep.c Depth: %d %s States to processArcs to processRegular expression path*** Warning: nested ^[ ignored. *** Input # %ld: %s No result. RE_STACK is not empty!RECURSIVE_COMPILE_REPLACE^[]%^ %[ -> %^%[, %^ %] -> %^%]No occurrences of '%s' and '%s'. ^[^]*** Aborting COMPILE_AND_REPLACE_SELF(). Not enough memory for this operation. %ld regular expressions compiled successfully. No errors. %ld error%s s\[%^%[ | %^%]] -> 0 || _ $%^%[ , $%^%] _ $%^%[ *** Extracting regular expression substrings... *** Calling compile-replace... ~$%^%[~$%^%] *** Composing the final result... net_%xnetwork(%s). symbol(%s, ""arc(%s, %ld, %ld, final(%s, %ldSorry. This network is too large to be saved as a prolog file by xfst. You need to license a professional version of this program. *** Error on line %d in file '%s. .        !"#$%&'()*+,-./01234567l69j:?I+\ OIGTTTTTTTT TTTTT TT TTT T''''''' TT'''        SR !"#$##QP##4#5#%%O######%#&####%%%%%%%%%%%%%%%%####'(')*+,-,,..,,),),((),,,,,,(,N,,,,((((((((((((((((,,,,/0M00LK0000&&J000000&0&0000&&&&&&&&&&&&&&&&00006I7HGFED3889:;<=<<>><<9<9<??9<<<<<<?<@<<<<????????????????<<<<AB$BB21BBTBTBCCTBBBBBBCBTBBBBCCCCCCCCCCCCCCCCBBBBTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTQP NL   K J IHGFE 89:;<589:;< 4=321 !=!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!'''''''''''''''''''''''''''''''''''''''''''>?@>?@TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTfatal flex scanner internal error--no action foundfatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowinput in flex scanner failedflex scanner push-back overflowout of dynamic memory in yy_create_buffer()out of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()%s        1+,-  "(-) )* !' 0"!#2$%/&3(.    $ /     parser stack overflowC-fsm error: cannot intern symbol in function make_fst_label()C-fsm error1: cannot intern symbol in function intern_unicode()parse error*** %s at '%s'   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrssssttuuvvvvvvvwwwwwwwwwwwwxxxxyyzzz{{{||||||}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~kl.mhijqrstu "$%#&_cfg/0wyv|+\aH(I:;JKLMNO1 !=?PRTV[<>QSUW`po,* ^]ACE2367X')_cY@BD4589Zbnx{z}~eGF-d !"#$%&'()*+,-./0123456789e0#******oe** +JLW(E^0<J<<<00************** ** **#l0000UUUUUUU*GPTSEG*  Zbm!-]cz%*'pd0@M?OPAQCCCCC:;RSDFCCHJLRSvgi BERSGIKfh jkmnoCCCCCCRS_`  <>wxyz @ |}~yz|}~ jk =mnoq  jkmnoyz {|}~     jk l mnopqVWXY N Z[\_` rstubcdVWXY  Z[\_`a bcd  yz{|}~TUVWXYZ[\]^VWXY_`VWXYaZ[\bcdZ[\yz_`|}~_`bcdbcd  mno {|}~178 "#@ 78("#( 78TUVWXYZ[\]^_`a"#.e(lmno:;::;:;#$ {|}~+,-Bvwvwpq%('vw%'cpqc@c@vw*@@78*@FGpq _`ab1 %'(& #$.(8+,-9#$:;(vw+,-&vw2./1A:;<=>cRS O#$+,-2cd&fghijk./1#$:;<=>+,-2 O#$()+,-02cd&fghijk./1:;<=> Olmnocd&fghijk./1:;<=> #$)+,-02 !"c&efghijk./1345:;<=>AAFG lmno\]^ !"c&fghijk./1345:;<=>FG O\]^cd&fghijk./1:;<=>#$)+,-02 !"cfghijk3456789@ !"FG !"Olmno345\]^345#$FG(C+,-HFG2PQRS\]^XYZ[e\]^CDEHIJKLMNPQRSTUVWXYZ[parser stack overflow%s:%dC-fsm error: cannot intern symbol in function make_fst_label()C-fsm error: cannot intern symbol in function intern_literal()C-fsm error: cannot intern symbol in function intern_unicode()Function %s) is not defined parse error*** Regex error at %s on line %ld in '%s' *** Regex error (%s) at %s too many errors (%d): trying to terminate processing rFile '%s' was called by a regular expression. It could not be opened. File may not exist and is not opened.File '%s' was called by a regular expression. It was already opened on a higher level. This kind of recursion is not allowed. -File '%s' was called by a regular expression. It does not contain any regular expressions. *** WARNING: File '%s' was called by a regular expression. It contains %d regular expressions. Only the first expression was used to create a network !!!File '%s' was called by a regular expression. It does not contain any binary network. *** WARNING: File '%s' was called by a regular expression. It contains %d binary networks. Only the first network was used !!!File '%s' was called by a regular expression. It does not contain any prolog network. *** WARNING: File '%s' was called by a regular expression. It contains %d prolog networks. Only the first network was used !!!No network(s) created File '%s' was called by a regular expression. It has a wrong type specification after '@'. **** PROGRAMMING ERROR **** Please, inform the programmer. Temporary file could not be opened, to parse the string: %s %s ; RE2N_TMPFILE **** PROGRAMMING ERROR **** Please, inform the programmer. Syntax error found in regular expression from string: %s $() **** PROGRAMMING ERROR **** Please, inform the programmer. Syntax error in variables of a regular expression. **** PROGRAMMING ERROR **** Please, inform the programmer. Variable '%s' of a regular expression not found in stack. %s %%%d .RE2N_VAR. %s %d Error in regular expression: %s RE2N_substitute_varsAA | BBB B | C C C -RE2N_create_var_stack **** PROGRAMMING ERROR **** Please, inform the programmer. Attempt to save variable '%s' twice to the stack in 'RE2N_save_var()' RE2N_save_varlluuxwwqd qVqSo45HI_J^Yaj ;b<c26[7]`\qMGZhsrwllwwowwowutuvdgpWXooooko,@B DCEAoi(:$)#89F flllllllllomooooooututeoo+'?ON>Q= *1. nlllooooo&%LKUTRP-/llllllooo"!0o3  !"#$%%&'%(%%)*+%,%%%-%%%%./0123%4%%5%%%6%%789:;%<=>?%%@%%ABCD%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%  748CJPRMTn/)"!UYARRRMRRRR*V5R&;6R:RRRRqRfRRRLRDLR(RR,-RRRR/0RU|4thRry%vtRRLkePRRRU]\RRZRYR"@RRRR;DRRRRRRRRaQcR'lLRUYl6RzR vB~ajRR_ZRR=RR!RRRRRRRRRRRR0W8^avf*+/0:EIJRRRRRRRRRaRRRR>RW^xO_LmdRRRRR-RRe.P5GRR R #*38?HBBACCDDEEFFBBGGABBBBHHIIJJBBAAAAAAKLAAMANAAAAAAAANAAANANAAAAAAAOAAAAAAAKAAAPPAQARLSTSSOUAUAAAAAKLAL'AK'AAVVVNMANAAAAAAAAAAAAAAAAAAAAAAAAAAANAAAAAAAAAAAAAAAWAAAAAAYYYAAAAPPAQRRQQRXQQRAQSTASYYYSSUAUUAAA'VVNAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAXARRRXRSYYSAVVAAAAAAAAAAAAAAAAAAAAAAAXXXXXYYAVAAAAAAAAAYAAAAAAAAZAA[AAAAAAAAAAAAAAAAAAAAAAAAAAA"##$"%&'()*+,-./01234+++56789:;++++++++++++++<=>?@A+++++++++++++BCDEHHI=JJHHIJ JO O R [S [R\jS \KPkP<K TU V U WUUU W W UXUUUUUUUUUUUU UUUUUUUUUUUUUY ``dsp;dqAAturvAArar:9ebbbebbbfbgbfhbbbbbbbifffbbbibibffffffffffffffbbbbbbfffffffffffffbbbbmdm8nnmm7mm``AAnnanmnmem6nmnmy5z{|}~3/.-,AA+*)pq%pq  ppqqr>>rr&&&pqpq 400144  blbmmnnmmmmnn>>nmnmm'''>>nmnmpqbbbbbbbgbhbbbbbbbbbbbbbbbbbbbbbbApAq001444 !""""""xAwA_#A!!$##!$$b!Fbpp!qq!'AA(A''2((A22pAqA$AAAA(2$A$AA(2(2 GGGGGGGGGLLLLLLLLLMMMMMMMMMNNNNNNNNNQQQQQQQQQZZZZZZZZZ]]]]]]]]]^^^^^^^^^bbAbbbbbbccAcccccclllllllloooAAAAAAAAA?????????@@@@@@@@@AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA;=N z(z=NHH ( :##&,+9T+4OQ4,Q,+,8478+#+484877O7ZS888SZ7&'''T'''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''')c)6))))5)\)``:\:))555:???:5:`t))))c);U5U3t?;?;U))))2.UU5i22222i;i2%FFF;;;;v?F222vv2F222222222BB BBBBFBWBWXXBBW  XWWXlXlBBBBBXlllBBBRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRVVVVVVVmVmVVmaaammnoanoVVVVVnoa<<nonoVVVVYYYYYYaYrYrYYrrrYYYYY&&&YYYggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggpppppppppp??ppppp'''@@pppp   !!!"""|{yxus_0004KC<943410!###$#$#(2(2$(2$$(2(2BBBBBBBBBCCCCCCCCCDDDDDDDDDEEEEEEEEEFFFFFFFFFGGGGGGGGGHHHHHHHHHIIIIIIIIIJJJJJJJJJKKKKKKKKLLLLLLLLMMMMMMMMNNNOOOOOOPPPPPPPPQQQQQQQRRRRRRRSSSTTTTTTTTUUUUUUUUUVVVWWWWWWWXXXXXXXXYYYZZZZZZZZZ[[[[[[[[[AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA ...Warning: missing semicolon. Character '%c' (0x%x) does not belong to any character group. It may cause unexpected results. warning: non-printable character 0x%x encountered. flex scanner jammedfatal flex scanner internal error--no action foundfatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowinput in flex scanner failedflex scanner push-back overflowout of dynamic memory in yy_create_buffer()out of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()%s rOpening file %s... The file %s is probably in a binary format. Closing file %s... *** INTERNAL ERROR. THE READER IS CONFUSED. PLEASE REPORT THIS!!! Regex flex problem in regex_tg_flush_buffer_restored(). *** Warning: %s () RESET_STRING_MEMString size too longALLOC_STRING...LEX_ADD_PROPClass name should already be a labelinit_sublexicon<<<>>><<>><<>><<<#>>>Building lexicon...Sublexicon is mentioned but not defined.No sublexicons defined!*** Warning: Sublexicons defined but not used: Minimizing...Done! *** Warning: Lost all entries containing the following symbols: #begin_lexiconss*** Compilation aborted because of %ld parse error%s. , Sublexicon is declared more than once.Ignoring info strings.CLASS has should already be interned as a labeladd_class_to_input *** Warning: Cannot parse '%s'. NOTE: If you declare MULTICHAR_SYMBOLS instead of ALPHABET, all undeclared symbols are parsed as single characters. If neither set is declared, then all symbols are parsed as single characters. *** regex error *** line %ld: Regular expression error: '%s'   !"#$%&'(   & '$* #("%#)! J   /!"0 1$ %$&"( $&( $$-'$$$$89)5 '638-.=4:&(?;%,B27E<FG HI#@A#+#CD5#9>KL* )&(,% 2+! 7$ '<+@A CD 34 :; % + parser stack overflowparse error line %ld: %s at '%s'                     !"#$%##&'()##*+,-##./#0123456789:;#<=##>?@A##BCDE##FG#HIJKL################################################################################################################################J{QqcaaaHNaaa1,4+>@\PZiaIms`yD}aFD3$ D )6BN[osbv^ #0HUmz'CPD&h3KXtzu (6@N[s`zVlP*?M[aGaGsxG+@+m}rgGT;W8D';"4a!$(,048<@DHLPTX\                             23E GIM K`!"#$%&)' *FHJLhMi hi(no2 )3 q *3!"#p$%&',d-.,/-.aa/aMM`` (` 456547755554589Mh4i4599999999999999999997575449999999999999999997574:;:<==>?=?>::??@?>?AB==C>C>?BBBBBBBBBBBBBBBBBBB:?:?>>BBBBBBBBBBBBBBBBBB:?:>:N_NOVOh{iPQPQdRSRSTgTaaMagWgkXklnloYZNUOU[\00]pPQhiRSaTN||O|g^oPQNgOkbSlUTnPQodNRSO0TaaapPQNgUORSaTmeQcURSaT2Nm3OUPQN|OfSaUTnPQoNRSOT|||pPQNaUORSaT_PQVU{NbSO_T{PQNUOrRSaTmeQMU`RSayTmxcNOUwvMPQWuXUfSauTmYZnto[\0M]pWsjXDrpUDMYZWDX[\|^]_YZ}\0M]pWXm^YZ[\|^]_MWX~MZWX^[\|]YZM`\|]_NaO_|^PQN_OVRS{^TPQRSTNOUPQNORSaUPQRSTNOUMQWXRaUYZ[\0M]WXUMYZWX[\^]YZ[\|MWX^MYZWX[\^]Z[|^NO_^eQRSaTNOPQNORSUTPQRSNOUPQRSaUTzMWXUMZWX[\|]YZ[\0M]WX^MYZWX[\^YZ[\|]^_^__V{zz__M`_zz_V{z__zz_z++++0001111MMMVVVV____gggjjjjmmmmzzzzppppaaa|||  + +,,..1133.$$$$N_N_O``OggWW/W/R/RRRl-l-lh-h!!-h!!ii[!!!!"[["[ioo""#j#j""j!"m##mb%##%j#bbbm%%'p"'p%%%%k''k"#k''''q(q(kb%((MM((('(nMMn}PMMPM}}}nPPQ(QyPPPxPzQQzwMzSQQS{Qv{ts{SST}PTrSSSXSTTQTTTLTKQUUSJIVUUVHVTUUUGUVVFVVVYVYEYD8U)ZYYZ ZYYYVYZZZZZ\Z\\Y\\\\\Z\]]]Z^]]^^\]]]]^^^^^^aa]aaccaa^accccccddaddeedddcdeeeeeeffd|ff||fffef|||||~|~~f~~~~~|~~                   fatal flex scanner internal error--no action foundfatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowinput in flex scanner failedflex scanner push-back overflowout of dynamic memory in yy_create_buffer()out of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()%s ***Illegal use of '' as an ordinary label. The complement operator ~ is defined only for regular languages: ~A denotes the language [?* - A]. You must use the expression [[?:?]* - A] instead of ~A if A represents a relation. The term complement operator \ is defined only for \A denotes the language [? - A]. You must use the [?:? - A] instead of \A if A represents a relation. 12ir*** %s is not valid: 1 = upper, 2 = lower, i = invert, r = reverse *** Error in a %s statement. %s must be a simple network, not a transducer. CENTERrestrictLEFTRIGHT Aborting. Returning ?* instead. Wrong arrow typeSIMPLE_RESTRICTION******* The -> operator cannot be applied to a transducer. *******Shouldn't happenMAP_TO_EPS%s:%u: failed assertion replace.c...*** Sorry. Cannot apply to a net containing: , or . *^^**<<**>>* ***** ERROR in PARALLEL REPLACEMENT: %s *UPR-AUX**** Only one '%s' allowed in an insert clause! *** Sorry, insert option is only supported in directed replacement. '%s' is not allowed here yet. All UPPER, LOWER, LEFT and RIGHT must be simple fsm, and no transducers. Invalide arrow type%s%d***EPS-SINGLE**eps_single**EPS-MULTIPLE**eps_multi**STR-BEGIN**str_begin**STR-END**str_endboundariesallall**APPLIC-LEFT**APAPall|>APbracketsepsilonseps+brsall_auxreal_symbolBrUpperNoBrUpperApBrUpperNoApBrUpperwrong upwards_p in 'repl_struct_to_nvv' *<%d-*>%d-UPPER*** ERROR: INSERT_SYMBOL occured in %s LEFT contextRIGHT context*** ERROR: Chunk markers must not contain OTHER. @BrUp~$@++++ANCRE++++~$BrUp*** PROGRAMMING ERROR in Parallel Replacement: Recursion depth > %d reached PLEASE, WARN THE PROGRAMMER. wrong context direction*CPR-AUX*** ERROR in Parallel Replacement: Arrow variable must not have value %d. test01 functions for Conditional Parallel Deterministic Replacement are not implemented yet. **** Every context of the restrict operation has to be a simple fsm and not a transducer. *RST-AUX* Aborting. Returning [?*] instead. RESTRICTION IN MULTIPLE CONTEXTSExpecting an empty final stateREROUTE_ARCSStates to copyNetwork not in correct format. Cannot proceed. Network not in correct format ( ) Positive integer expectedREGEX_PARSE Cannot use the definition of '' in ':' because it denotes a relation. Cannot compile the product. rb*** Cannot open %s *** "@" operator returns first net only. Ignoring additional nets in "%s". *** Nothing in REGISTER %d rbcfsm: "%s" contains no machines. cfsm: warning: "%s" contains more than one machine. CFSM-ERROR: state numbering finds that the number of states in the state list does not match the state count. Warning: cfsm_remove_arc: arc not found cfsm_get_prop: unsupported property typecfsm.read_object: error reading listcfsm: cfsm_set_prop: error reading property value CFSM-ERROR: cfsm_label_symbol label has more than one symbol CFSM-ERROR: symbol found not to be arity 1 *** CFSM FSOPT INTERNAL PROGRAMMING ERROR *** Please, inform the programmer. Flag diacritics (instructions) on both sides of a label pair. The complement operator ~ is defined only for regular languages: ~A denotes the language [?* - A]. You must use the expression [[?:?]* - A] instead of ~A if A represents a relation. symbol pair not allowed in sigmaSINGLE_CHAR_SIGMA_FSMOnly FSM-s allowed.MULTI_CHAR_SIGMA_FSMOTHER not handled yet.BOUNDARY_SYMBOL not handled yet.Circular.more than %lu paths.more than max. number of allowed paths.symbol fsm is not as expectedPARSE_UNICODE_STRINGsymbol pair not allowed in an fsmString parsed to ID-s: %d, String parsed to characters/symbols: Input alphabet contains OTHERSIGMA_BUTIllegal label idREPEAT_LABELMAX less than MINREPEAT_FSMCannot add fstpair to sigmaCONTAINS_NO_LABELCONTAINS_ALLComplete is not implemented for transducers. Aborting. EPSILON in the sigmaCOMPLETE_NETEPSILON found in a net marked as epsilonfree.Two altchain arcs in one state.COMPLETE_SIDEEPSILON, OTHER, and ALTCHAIN_SYMBOL cannot be used as a fail_tag. Aborting.Copying the original network... Extracting the upper side of the network... Extracting the lower side of the network...Side neither UPPER nor LOWER Complementing...%ld states, %ld arcs added. Merging original net with the complement... Done. Can't compute the negation of an optimized network. negate_netUn-optimizing ... Bad side_p argumentIGNORE_ALPHX:XCONCAT_LABELCan't concatenate optimized networks. concat_fsmCan't compute the union with optimized networks. union_fsm_auxCan't compute the union with an optimized network. Unioning ... State count is 0 but statelist not emptyUNION_FSM_AUXINTERSECT_FSMINTERSECT_PGET_LOWER_ARRAYMAKE_ARC_STACKSCompose arcs to doMAKE_LOWER_MAPBad argumentFLAGS_PRESENT_P*** Warning: It is unsafe to treat flag diacritics as special in composition when both networks contain flags. Please set the variable compose-flag-as-special to OFF. compose_fst_pairComposing ... COMPOSE_FST*** Warning: Only regular languages and equal length relations are closed under intersection. This network appears to represent a relation that includes pairs of different lengths. The result may be incorrect. Can't intersect with an optimized network. new_intersect_fsmCan't run the minus operator with an optimized network. minus_fsmMINUS_FSMMinus arcs to do%s:%u: failed assertion calculus.cN2 not deterministicLabel alphabet not correctly maintainedMIN_FSM*** ERROR: wrong side-parameter in 'oneside_minus_fsm' *** Aborting crossproduct. %s. Operation is not applicable to a transducerNot enough memory for this operationSorry. %s flags cannot yet be eliminated. Odd label arityELIMINATE_FLAG_ATTRIBUTEINSERTUnknown flag actionINIT_STATE_MANAGERNew pair statesINDEX_NET is not OLD1 or OLD2The merge operation cannot be applied to a transducerMERGE_FSMVECTOR_REFNOTE: Making start state final on empty sequence. SEQS_TO_NET %ld words so far. Compressing intermediate nets. WORD_FILE_TO_FSMNETWORK_FROM_TEXT_FILE0?%! Not expecting an FSTLABEL.PRINT_FSM_PATH*** Aborting. Network is circular. Arcs to writeNETWORK_TO_TEXT_FILEMAKE_IO_SEQUENCEMAKE_IO_SEQ_TABLEASSURE_IO_SEQ_TABLE_SPACE INITIALIZE_APPLY_CONTEXT?Error in solution tree: non final leaf state detected... This is an upwards bimachine. It cannot be applied downwards. This is a downwards bimachine. It cannot be applied upwards. Network has an epsilon loop on the input side. *LEFT_CONTEXT**NON_LEFT_CONTEXT**RIGHT_CONTEXT**NON_RIGHT_CONTEXT**AND_CHECK**OR_CHECK*%s:%u: failed assertion apply.cMaximum context length (%d) exceeded. Check fails Warning: a found but no check followed. Expecting a context marker. Found '' instead. Pattern # of matches - %7d Total: %7d Unsupported format: can't process this network... The two halves of an upwards bimachine should be on the stack in the opposite order: RIGHT, LEFT. choose_nets_to_applyNet vector length %d, attempting to access position %dnet vector contains bimachine with only left netnet vector contains bimachine with only right netcreate_apply_context_vectornet vector contains bimachine with bad flagsrecurse_depth_1st_applyrecursion level %d with context vector of length %dputNot a bimachine or incorrectly markedParse table cannot be createdNothing to do: The network has not been optimized. WARNING: in function '%s' %s SHARE_delete_altchain_arcs()ALTCHAIN arc is not the last one in the arc list. Initial (now probably corrupted) net will be returned.States to copyALLOCATE_SEQUENCE_DATAGET_SEQUENCEallocate_sequence_dataUnrecognized data type: %d COPY_BYTE_BLOCKCOPY_IO_SYMBOLCOPY_SEQUENCEcopy_objectCannot copy a symbol package outside of a sequence. Tabular and compacted nets cannot be copied.COPY_FSM*** Programmer alert! State count in COPY_FSM is %ld, should be %ld **** Programmer alert! Arc count in COPY_FSM is %ld, should be %ld Start state does not belong to the net End state does not belong to the net End state is not reachable. States do not belong to the net Definitions*** Warning: Defined symbol '' occurs as a component in ''. *** Incorrect 'define_label_set'. Too many states.. %d [shape=doublecircle, label="fs%d"]; %d -> [label=" XFST-DOT interface error. Too small buffer=DOT_BUFFER_SIZE. Please report this. \n"]; } /* Net: */ digraph namedno_name { rankdir = LR ; orientation=landscape ; ranksep =".15" ; /* default shape for nodes */ node[shape=circle,height=".25"] ; netname [shape=polygon, sudes=4, label="dot -Tps ** Shall DOT display this big net?TMPDIR/tmpdot_** creat() failed for DOT temporary file. Name is"%s". ** creat() errno=%d. w** fdopen() failed for DOT temporary file. Name is"%s" errno=%d. ** Unsuccessful fsync() on DOT temporary file; errno=%d. ** Unsuccessful DOT temporary file close; errno=%d. -o .ps ; gv .ps &Please delete: "%s" if not needed any more. ** DOT temporary file name too long. ** Unsuccessful DOT temporary file creation. Unsupported file format: cannot load this network. cannot write network to file. States to reachBad argumentLABEL_LENGTH %d arcs traversed, in %d maximal depth. Net incorrectly marked as loopfreeSTART_LOOPS_PSublanguage state pairsSUBLANGUAGE_PEquivalence state pairsEQUIV_FSM_PBad arityEPSILON_LOOP_STATE_PShouldn't happenStates to connectINVERT_TUPLEUnaccounted labelLABEL_CHECKUnaccounted labelsUnexpected labelBINARY_LABELS_ADD_TOindex_pathsNot a legal visit_mark %d INDEX_NETSYMSUBSTSYMSUBST_MODIFY Cannot substitute for an fstpair. Cannot substitute an fstpair. String too longLABEL_NAME_FROM_STREAMNo nets. Symbol substitute aborted. '%s' deleted. '%s' replaced. %ld arc arcs removed added in %d nets. . No changes. Symbol '%s' does not exist. *** Warning: '%s' cannot be unambiguously interpreted. Upper symbol = '%s', lower symbol = '%s' Old symbols: No changes. New symbols: Symbol '%s' does not exist. SIGMA not closedCLOSE_SIGMADETERMINIZE_GET_STATEStates to determinizeDeterminizer indicesDETERMINIZECan't determinize an optimized network. determinize_fsmUn-optimizing ... Determimizing ... MINIMIZENo equivalence class for OTHER found.COMPACT_SIGMAResuming. Operands of any stack-modifying operation will be lost. States to rmapProgramming errorLEP_copy_sectionLEP_eps_push_in_tailWrong arc label arity %hi in argument networkLEP_local_eps_push_fstThe add_path operation currently does not handle compacted or vectorized or labelset reduced transducers. Path is already in the network ---> exit. add-words is not yet implemented ... word: %d model: ---------- %s States to printPositions to rememberArcs to printAttributes to rememberValues to remember.. Word count: %ld (actually, infinite) s%.1f Gb%.1f Mb%.1f Kb%d bytes%s:%u: failed assertion net-io.c. %ld state%s, %ld arc%s, Virtual, Circular, more than %lu paths, %lu path%s. Tabular. . Compacted. . ANnk(It$Dz: (no arcs) -> [non-det, States: ( real), Arcs: Operation: operand 1: operand: operand 2: Net: Flags:*** Sorry. Have trouble finding valid paths in this net. *** Quitting after 50 failed attempts. Buffer size exceeded: %d. Word not foundWORD_FROM_NUMBERNetwork is empty. ADJUST_PATH_INDEX_VECTORCan't compute path numbers: the net is not indexed ! Argument too large: %ld. Argument is neither UPPER nor LOWERWORD_TO_NUMBERNo WORD-TO-FILEPOS-MAP on the index net! --> Level (= (final)Arcs: Sorry. Cannot inspect a virtual net yet. States inspected'N' transits arc N, '-N' returns to level N, '<' to previous level, '0' quits. Inspect: <0State names range from 1 to %d Arc names range from 1 to %d Output buffer full, please increase MAX_TALLY_ID_LENGTH to at least %d States to renameIncorrect state countTOP_SORT_NETreorder_arcsCannot reorder arcs when arcs are shared! Too little space to reorderREORDER_ARCS? node: {borderwidth: %d title: ""} edge: {sourcename: "" targetname: "" label: " XFST-VCG interface error. Too small buffer=VCG_BUFFER_SIZE. Please report this. \n/* Net: */ graph: {title: "" splines: yes display_edge_labels: yes orientation: left_to_right layoutalgorithm: mindepth crossing_weight: medianbary crossing_phase2: yes layout_nearfactor: 40 late_edge_labels: yes node.shape: ellipse edge.thickness: 2 edge.arrowstyle: line node: {borderwidth: 1 title: "" shape: box} } xvcg ** Shall VCG display this big net?TMPDIR/tmpvcg_** creat() failed for VCG temporary file. Name is"%s". ** creat() errno=%d. w** fdopen() failed for VCG temporary file. Name is"%s" errno=%d. ** Unsuccessful fsync() on VCG temporary file; errno=%d. ** Unsuccessful VCG temporary file close; errno=%d. ** VCG temporary file name too long. ** Unsuccessful VCG temporary file creation. BTREE_HEAP cannot be reinitializedinit_btree_memBinary treesINIT_BTREE_MEMBT_INSERTBTREE_INSERTCONS_HEAP cannot be reinitializedinit_btree_memCons cellsinit_cons_memDBLheap cannot be reinitializedinit_dbl_memcouldn't allocate memory for DBL_LINKsinit_dblcouldn't allocate DBL_LINKdblalloc** ERROR: %s in '%s' (%d) ** Press return to exit. %% Warning: %s in '%s' (%d) Out of memory%s Negative or zero length PROGRAMMING ERROR in %s() : ---- Please report ---- error_bufferMissing actionputAction 'put' requires non-NULL message clearlastallBad action '%s'This command cannot be applied to a virtual net THIN_TO_FATTHIN_TO_TEMP_FATFAT_TO_THINCHARCODE_TO_FSTRINGINTEGER_TO_FSTRING@NETWORK_FROM_FILE%c<%d,%d>Illegal hex valueFPRINTF_CHAR_AS_HEX\x\u"\v""\b""\r""\t""\n"" ""%c"\v\b\r\t\n\\\"%s%0%?%%"\f"MAKE_HASH_TABLE%s: %4ld bytes, %7ld in use, %7ld total (%ldK) * Heaps * Total: %ld Kbytes. Heap name longer than HEAP_NAME_MAX_LEN charactersINIT_HEAPcouldn't allocate memory for cellsLoop in the free listHEAP_ITEMSADD_BLOCK*** ERROR: Not enough memory. Cannot continue. This is the situation: Total %ld bytes in use. can't allocate from null heapcell_allocERROR: cell %p already freed cell_size must be larger than a pointerfree_cellFreelist is not emptyMAP_HEAPINIT_LAB_VECTORADD_LABEL_VECTORMAKE_LAB_VECTORASSURE_LAB_VECT_SPACEcreate_lab_enumeratorAttempting to create an enumerator for a NULL vector. CREATE_LAB_ENUMERATORMAKE_LAB_VECTOR_TABLEASSURE_LAB_VECTOR_TABLE_SPACE MAKE_LAB_VECTOR_RING%s:%u: failed assertion lab-vect.c*** Error: Expecting an initial { and final } in %s *** Bad character in atomnum: %c *** Error: "%s" is too large for an octal number. Max is "\377". *** Error: Expecting an initial " in %s *** Error: Expecting a final " in "%s %s: %s >>> SCRIPT: %s%s %s (y/n) [%c]: Please answer 'y' or 'n'. Input file (- = stdin) [cancel]:Input file [stdin]:Cancelled. stdinrInput file [cancel]:rbOutput file (- = stdout) [cancel]:stdoutwOutput file [cancel]:wbImproper modequery_fopen -Warning: Script will not contain stdin keystrokes. %sCREATE_STACKUnknownStack name more than STACK_NAME_MAX_LEN charscan't push onto NULL stackpushout of memory, could not allocate new heap%s: %5ld max depth, %5ld depth, %5ld bytes (%ldK) * Stacks * ================================================================ Total: %ld Kbytes. MAKE_STRING_BUFFERASSURE_SPACENegative or zero lengthMAKE_VECTORASSURE_VECTOR_SPACEcreate_vector_enumeratorAttempting to create an enumerator for a NULL vector. CREATE_VECTOR_ENUMERATORMAKE_VECTOR_TABLEASSURE_VECTOR_TABLE_SPACEGET_FAT_STRGET_ENCRYPTED_FAT_STRGET_IO_SYMBOLGET_BYTE_BLOCKRead errorGET_SEQUENCEIllegal object typeget_objectIllegal sequence typeget_sequenceUnimplemented object typeget_atomsIllegal symbol typeNETWORK_FROM_FILEIllegal negative labelGET_ALPHABETno state at locget_arcStates to readRead failed. Not enough memory for %ld states. 100%% 0%%arc count mismatchGET_ARCS_AND_STATESstate count mismatchGET_ARC_BLOCKTwo epsilons?REMOVE_EPSILONNo epsilons?Unrecognized file type: %dCompactedfewer than 1 state expected!NETWORK_FROM_STREAMStandardbyte count mismatchnetwork_from_stream*** ERROR: file contains a transition tablewhich cannot be read in this implementation. Unsupported file format: *** The application is not permitted to load this file. You need a licensed version of the program. rbCannot open '%s' File cannot be loaded. NamesAUTHORSCHARENCODINGCHARNAMESCOMPACTED-PCOMPOUNDHARCOPYRIGHTDATEDIACRITICSEQV-VECTORFUNCTIONLANGUAGELITERALNAMESNETWORKNAMENEUTRALLINKINGCHAROPERATIONPOSTFIXLINKINGCHARPREFIXLINKINGCHARSAVED-SIGMASIGMASOURCESTATUSTAGSTOOLVERSIONSTRANSCRIPTTYPEVECTORIZE-NVERSIONSTRINGWORD-TO-FILEPOS-MAP0?NILTOTHERINTERLISPLISPParse table vectorsParse table nodesNetworksAlphabetsStatesArcsArc vectors%XMAKE_NETWORKARC_ALLOCALLOC_STATE*** Problem with arc label '' key item out of rangerenumber_arc_labelsarc label out of rangeALPHABET length exceeds MAX_LABELMAKE_ALPH_ITEMSlog(max) exceeds 'MAX_LV'Label vectorsBad typeMAKE_ALPHCannot allocate alphabet larger than MAX_LABELBad label idLABELS_TO_ALPHProgrammer alert: EPSILON in SIGMA. can't adjust null alphadjust_alph_sizeBINARY_TO_LABELLABEL_TO_BINARYThis function is obsolete. Call adjust_alph_size() insteadexpand_sigmaProgrammer alert: two occurrences of the same label in a label alphabet. NET_labels unspecifiedupdate_net_labels_and_sigmalabels and sigma must be either both NULL or both non-NULLADD_PROPMAKE_OBJECTMAKE_SEQUENCEUnknown typeADD_PROP_OF_TYPEExpecting a list of two stringsUPDATE_SUBLISTExpecting a list of stringsPAIR_TO_LISTValue of TOOLVERSIONS should be a list of lists.MARK_VERSIONIllegal ALPH maxFREE_ALPH_ITEMSMAKE_BYTE_BLOCK%s:%u: failed assertion struct.cWrong file format: can't free the network...FREE_NETWORK*** ERROR: network contains a transition tablewhich cannot be handled in this implementation. MAKE_ALPH_VECTORMAKE_NVEXPAND_NVPOS out of rangenv_insert*** No net at position %d nv_extractNV_APPENDMAKE_NVVNVV_APPEND***** ERROR in %s ***** %s : %d and %d APPEND REPLACEMENT STRUCTUREdifferent arrowsdifferent context directionsmake_vector_state*** Nonfinal ALTCHAIN arc %s:%u: failed assertion vectorize.cVECTORIZE-NCan't vectorize a non-deterministic network. vectorize_netNet arc vectorsmake_vector_state_from_reduced***make_vector_state_from_reduced(): Nonfinal ALTCHAIN arc *** ERROR *** counting error in vectorization of dense states VERSIONCREATION-DATELANGUAGESOURCECHARENCODINGAUTHORSCOPYRIGHT%d. %s: %s (none) Please type a number (1-%d) [cancel]: Cancelled. Cleared %s. %s selected. Old value: New value [cancel]: Done. Write errorWRITE_BLOCKIllegal object typewrite_objectIllegal sequence typewrite_sequenceMAKE_TALLY_FILE*** Programmer alert: Wrong state count. *** Programmer alert: Wrong arc count. %4d.%6ld NET is not compactedRESTORE_TALLYNET arity incorrectly setWRITE_ATOMSArcs to write 100%% 0%%Write failed. WRITE_ARC_BLOCK*** Programmer alert: Wrong arity. Marked as %d, should be %d. Fixed. *** ERROR: network contains a transition tablewhich cannot be written to a file in this implementation. STATE_COUNT mismatch)network_to_streamARC_COUNT mismatchOnly %d nets present. Cannot write %d. wbCannot open '%s' Compact statesGET_DEST_STATECell not foundFREE_CSBad first byteINIT_COMPACT_NET_GLOBALSMAKE_FST_CONTEXTMAKE_DEFAULT_HEADERCOPYRIGHTAUTHORSCHARENCODINGSOURCELANGUAGECREATION-DATEVERSIONXerox CorporationFST Internal error: Incorrect side value: %d : Current value: SUCCEEDS. New value: FAILS. New value: (Neutral value)complement of Id of the flag value greater than 32767flag_actionUnknown action or testFLAG_ACTIONOdd label arityFLAG_ATTRIBUTE_OCCURS_IN_PGMT_DATE%B %d, %Y %H:%M:%S GMTNONEPUBLICLICENSEDRESERVEDXEROXUNKNOWNCannot set license type: not enough privilegeCHECK_LICENSEInvalid license typeensure_loc_spaceadjust_string_bufferCOPYRIGHT-NOTICECopyright (c) %Y by MAKE_HEADERDo not try to free a static header.FREE_HEADER File date is: %s Earliest possible date is: %s Current date is: %s *** The application is not permitted to load this file. You need a licensed version of the program. rbCannot open '%s' Unknown file type %d Bad file lengthGET_HEADERBad file dateBad header lengthBad license typeReserved header bytes not zerosBad copyright locationheader length mismatchREAD_HEADERWRITE_HEADERStart locations: No header. No files have been read or written. File name: Write date: Copyright notice: Net count: net netsFile type: Compressed IndexVery Old StandardVery Old CompactedOld StandardOld CompactedStandardCompactedFile version: File length: bytesNo files have been read or saved yet. **** Last input file **** **** Last output file **** .#. 0 ?%  0 ?%  Argument neither UPPER, LOWER, or BOTH_SIDESCOPY_LABEL_NAMENOTE: For atomic labels, the printing format is: id{'symbol_name}(has label data) For tuple labels, the printing format is: id(has label data) %3d. {''}(has label data) No such actionFLAG_DIACR_ACTION** WARNING: id of the flag value greater than 32767 ---> some flag actions may fail Attribute namesValue namesBad flag diacritic nameEXTRACT_NEXT_COMPONENTCannot parse the diacritic labelFLAG_DIACRITIC_NAME_PCLEAR SET UNIFY DISALLOW REQUIRE FAILINSERT EQUALITY TEST of Bad dataPRINT_FLAG_DIACRITICfeature '' to to the complement of with and Unknown action or test feature ' value ' :MAKE_FLAG_DIACRMAKE_SYMBOL_MAPSymbol namesKEYWORD**EPSILON****OTHER****DUMMY_SYMBOL****BOUNDARY_SYMBOL***ALTCHAIN* *_DET_EPSILON_intern_new_symbolINTERN_NEW_LABELINTERN_NEW_SYMBOL** ERROR: Too many labels. Maximum id number is %d Cannot continueTuple as a tuple constituent*** Warning: label '' is illegal: flag diacritics on both sides of the symbol pair. TUPLE_ERROR0?Unexpected end-of-file Write error. No space on device? Aborting. make_ch_nodemake_ch_node_nextInvalid hex numberSHORT2HEX*** Warning: Symbol %d is an empty string. MAKE_LOOKUP_TABLESCOLLECT_ATOMSSET_RANGE Missing labelmap_symbol_rangeGET_RANGE_MAPMAKE_RANGE_VECTORMAKE_MATCH_TABLEmake_match_tableThe nework does not have a reduced labelset. Unknown symbol: '' putNo parse table created because FSTs do not belongto a bimachine or are incorrectly markedNo parse table created because one or both FSTshave no label alphabetToo little space to reorderREORDER_STATESState count incorrect. Too low.State count incorrect. Too high.Output buffer full, please increase OUTPUT_BUFFER_SIZE to at least %d "\t""\n"" ""\r""\v""\b""\f" 0 ?% .#. 0 ?%  Size:s%d flag diacritic%s %d min %d sec %d sec ,deterministicprunedcompletedminimizedepsilon_freesorted_statesloop_freevisit_marks_dirtyshared_arc_listshas_arc_user_pointerclosed_sigmacompactedupper_sequentializedlower_sequentializedleft_bimachineright_bimachinereduced_labelsetvirtualKaplan compressedoptimizedArity:\x()'" %XIllegal Object type "Object"PRINT_OBJECT%ld'' "" Illegal Object type "Symbol_package"< >( )#Illegal Object type Illegal Sequence typePRINT_SEQUENCE: NewObjectNewSequenceSetSequenceLen   "  ! #$    parser stack overflowIllegal valueError foundInvalid Properpty NameInvalid Character definitionInvalid String definitionInvalid Symbol definitionError in Value Package no more supportedparse errorWARNING: %s at %s  @  @  @   @  @  @  @  @  @  @  @ @  @ @    @  @  @  @  @ @ @ @ @  @    @  @  @  @         "&+-125689:>?ADFGHIJMOPQRSUVVVY[\]^_bbcegklnqtwy{{{~    A-=CSUcu)9:FM_q  2DVhz #Q!16=O_foxvvwvvxvyvvwvvvvvvvvv vz{vvxvv| z}v~vvv&vvvv{v 8v8&v vM xv}&2v87J=<M8IvMONvhvgfhkvvvvvvvvvvvvvvvvv  YdYvvJdXrJAg "v#$%&v%&%&&&%&%&%&&&%(rv)*vvgvvv+&,,&v-vv,&,&.vv,v/0110v2vvv0v034vvv05665v7vvv5v589vvv5:;6:<::=>:?@v?@?@@@?@?@?@@@?@,,@vBvv,@,@Cvv,vDEvEEEEEEEEEFvvvvvvGIvvvvvvJ4vvvvvvvvvvKvKKKKKKKKKKvvKvLvvvKvKvMvvvKNvvNvOvvvNvNPQvvvN"v#$FvvvvvvG(vvTUE,,EvFvv,E,E+Gv,vW&vv&v&vvv&v&v&vvv&03v0303330303033305Zv5Z5ZZZ5Z5Z5ZZZ5Z66Zv[vvvZvZ8\vvvZIvvvvvvJ4;6vvvvvvvvvv]:^v:^:^^^:^:^:^^^:^vv^v_vvv^v^v`vvv^ZaaZv[vv,Z,ZA\v,vb@vv@v@vvv@v@v@vvv@EvvEvEvvvEvEvEvvvEfvvvvvvg4HcvHcHcccHcHcHcccHKvvKvKvvvKvKvKvvvKhvvhvivvvhvhvvvvhjvvjvkvvvjvjlvvvvjNhvNhNhhhNhNhNhhhNQvvQvQvvvQvQvvvvQ"v#$(vvno(vvTU3vv3v3vvv3v3v3vvv3ZvvZvZvvvZvZvZvvvZ^vv^v^vvv^v^v^vvv^cvvcvcvvvcvcvcvvvcfvvvvvvg4eqveqeqqqeqeqeqqqesvvsvtvvvsvslvvvvshvvhvhvvvhvhvhvvvhjsvjsjsssjsjsjsssj(vvno(vvnoqvvqvqvvvqvqvqvvvqsvvsvsvvvsvsvsvvvs(vvnovvvvv!!!!!!!!!'''''''''EvvvEvvEEHvvvHvvHHRRRSSSSSSSSSVvVV3vvv3vv34vvv4vvv466vvvvv6cvvvcvvcevvvevveemmmmmmmmmpvppqvvvqvvquvuuvvvvvvvvvvvvvvvvvvaG600GJ3%cJc g g  !!!&&&'''+++++++++++++-------22222222222222222777777777777777778888888888999;;;<<<<<<<<<<<<<<<<<=======AAAAAAAAAAAAABBBBBBBFFFFFFFHHHIIIIIIIIIIIIIIIIILLLLLLLMMMMMMMNNNNNNNOOOOOOOOOOOOOOOOOQQQQQQQRRRSSSVVVXXXXXXX[[[[[[[_______dddddddeeefffffffffffffffffhhhhhhhiiiiiiikkkkkkkkkkkkkkkkkmmmppprrrrrrrtttttttuuuwwwwxxxxxxxxxyyyyyyyyyzzzz{{{{|||}}}}}}}}}~~~vvvvvvvvvvvvvvvvvvvfatal flex scanner internal error--no action foundfatal flex scanner internal error--end of buffer missedinput buffer overflow, can't enlarge buffer because scanner uses REJECTinput in flex scanner failedflex scanner push-back overflowout of dynamic memory in yy_create_buffer()out of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()%s Unexpected type of SAVED-SIGMARECOVER_SIGMAIllegal object typeOBJ_TO_SYMBOL_IDWrong type of arrayOBJ_TO_TUPLE_IDUnexpected type of alphabet propertyPROP_VAL_TO_ALPHIllegal symbol typeBad alphabet typeRECORD_SIGMA*** Warning: '' cannot be unambiguously converted. Upper symbol = '', lower symbol = '' Net marked as TWOL net but isn't. Converting nets from TWOL to STANDARD mode. EQV_CLASSESinforce_singleton_classesBad callMAKE_EQV_VECTORMAKE_EQV_LABEL_SEQLabel not foundEQV_LABELSBad alphabet typeMAKE_EQV_PARTITIONUnequal lengthsALPH_len bigger than ALPH_maxThe labelset has already been reduced. DELETE_EQV_ARCSDoes not reduce: all equivalence classes are singleton sets. Cannot find the full label alphabet. Cannot find the equivalence class map. The labelset has not been reduced. Bad length for EQV_VECTORRESTORE_LABEL_SET%s:%u: failed assertion eqv-labs.cCannot restore without the full alphabet Nothing to do. The labelset has not been reduced. No EQV_VECTOR. Nothing to restore. RESTORE_EQV_ARCSbuild_arc_remove_alphinconsistent argumentsbuild_eqv_mappingempty equivalence class found%s:%u: failed assertion virtual-base.cCONFIG_INITHOMEthe Xerox Corporationontrueofffalse"%s", line %d: Invalid Boolean keyword '%s': must be one of 'on', 'off', 'true' or 'false' %s/.%sfsmrcrFSMHOME/usr/local/lib/%s%s/lib/%s"%s", line %d: syntax error at : %s copyrightcompletion ٌ  H  L 00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 0000jrj| ό Ϩ j8 oood( oo t   B@ ٰ ِ x X sx s` sP s@ s p p p o o o m mp m` mP m8 l k@ k0 k mP m8 j i i i h h h h g g sP g g g` gP g8 sP g g f f f sP g f e e e sP g e d d d sP g e c c c sP g cp bh bX b@ sP g b a a ` sP g ` _ _p _H sP g _ ^ ^ ] o ] ] [p [` [@ sP g [ Z Z Z h h Zx ZP Z@ Z( o g Y Y@ Y0 Y o g X XP X8 X sP g W W W Wx Wp W` WH U T T o g T TX TH T( sP g S S R R sP g R Q Q Q sP g Q P P P o Px PH O N N N N N M M M N Mp M@ L( L K sP g K J J J sP g Jx J J I sP g I Hp H` HH o H@ H G G G sP g Gx F F Fh sP g F0 E Ex E` sP g E8 E E D o g D D D C sP C C C Cp CP sP C C( B B B h B Bh A A A sP C A AX AH A0 sP C @ @ @ @ o @p @H ?P ?8 ? sP C > > >x >h sP C >8 = = = sP C =X = = < sP C < $$ t >$Id: lexicon.y,v 1.6 2002/05/31 23:31:43 lk Exp $  H$Id: fat-str.c,v 1.13 2001/05/31 10:21:59 privault Exp $ x h ` 8Th 4H0$Id: prop-io.c,v 1.8 1999/09/24 09:09:33 privault Exp $$Id: prop-io.y,v 1.5 1999/10/14 13:14:58 lk Exp $$Id: prop-io.l,v 1.3 1999/08/10 00:34:57 lk Exp $as: WorkShop Compilers 4.X dev 18 Sep 1996 as: WorkShop Compilers 4.X dev 18 Sep 1996 @(#)SunOS 5.6 Generic August 1997as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.2 19991024 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 ld: Software Generation Utilities - Solaris-ELF (4.0).interp.hash.dynsym.dynstr.SUNW_version.rela.got.rela.bss.rela.plt.text.init.fini.rodata.got.plt.dynamic.data.ctors.dtors.eh_frame.bss.symtab.strtab.comment.stab.index.shstrtab.stab.indexstr 7 88mjo -((  7@@$ Add KHHDQ όόW ϨϨ] e T T j t t o ٌ ٌx H H~      KP